BLASTX nr result
ID: Gardenia21_contig00017443
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00017443 (216 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO97281.1| unnamed protein product [Coffea canephora] 89 1e-15 ref|XP_002527518.1| conserved hypothetical protein [Ricinus comm... 62 1e-07 >emb|CDO97281.1| unnamed protein product [Coffea canephora] Length = 332 Score = 89.4 bits (220), Expect = 1e-15 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 1/51 (1%) Frame = +3 Query: 3 ALPLEASSEQDSEVG-VALSKEKSDKPSLDHEGTKISLDPKDVPRSRSYFQ 152 ALPLEASSEQDS+VG ALSKEKSDK SLDHEGTK+SLDPKD+PRSRSYFQ Sbjct: 64 ALPLEASSEQDSKVGGAALSKEKSDKASLDHEGTKVSLDPKDIPRSRSYFQ 114 >ref|XP_002527518.1| conserved hypothetical protein [Ricinus communis] gi|223533158|gb|EEF34916.1| conserved hypothetical protein [Ricinus communis] Length = 324 Score = 62.4 bits (150), Expect = 1e-07 Identities = 34/51 (66%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = +3 Query: 3 ALPLEASSEQDSEVGVA-LSKEKSDKPSLDHEGTKISLDPKDVPRSRSYFQ 152 ALPLEA S DS+V LSK+ KP+ DHEGTK S DP DVPRSRSYFQ Sbjct: 65 ALPLEAPSAPDSKVEAGVLSKDSEKKPNGDHEGTKRSSDPIDVPRSRSYFQ 115