BLASTX nr result
ID: Gardenia21_contig00017369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00017369 (205 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP04275.1| unnamed protein product [Coffea canephora] 93 7e-17 emb|CDP19852.1| unnamed protein product [Coffea canephora] 59 1e-06 emb|CDP21979.1| unnamed protein product [Coffea canephora] 59 1e-06 >emb|CDP04275.1| unnamed protein product [Coffea canephora] Length = 1483 Score = 93.2 bits (230), Expect = 7e-17 Identities = 48/67 (71%), Positives = 54/67 (80%) Frame = -3 Query: 203 EWEEVQRVSPYASTFERQEKMNNSLAREQRTGPLEETAFDKKQAHRNSVPSAPENNLEST 24 EWEEVQRVSP AS F++Q K NN A EQ+T PLEET+FD+K RN+VPSAPE NLEST Sbjct: 1372 EWEEVQRVSPDASRFDQQAK-NNKFAHEQQTVPLEETSFDEKPGRRNTVPSAPEINLEST 1430 Query: 23 PSRARNR 3 SRARNR Sbjct: 1431 TSRARNR 1437 >emb|CDP19852.1| unnamed protein product [Coffea canephora] Length = 121 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 104 LEETAFDKKQAHRNSVPSAPENNLESTPSRARNR 3 LEETAFD+K A RN+VPSAPE NLE+TPSRARNR Sbjct: 19 LEETAFDEKPARRNTVPSAPEINLEATPSRARNR 52 >emb|CDP21979.1| unnamed protein product [Coffea canephora] Length = 121 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 104 LEETAFDKKQAHRNSVPSAPENNLESTPSRARNR 3 LEETAFD+K A RN+VPSAPE NLE+TPSRARNR Sbjct: 19 LEETAFDEKPARRNTVPSAPEINLEATPSRARNR 52