BLASTX nr result
ID: Gardenia21_contig00017147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00017147 (271 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13313.1| unnamed protein product [Coffea canephora] 59 1e-06 ref|XP_009771483.1| PREDICTED: uncharacterized protein At3g61260... 58 2e-06 ref|XP_009591472.1| PREDICTED: uncharacterized protein At3g61260... 58 2e-06 ref|XP_010250815.1| PREDICTED: uncharacterized protein LOC104592... 57 4e-06 >emb|CDP13313.1| unnamed protein product [Coffea canephora] Length = 194 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 270 EKADYIRRTGHMPSSFSFKLPSFCW 196 EKADYIRRTGHMPSSFSFKLPSFCW Sbjct: 170 EKADYIRRTGHMPSSFSFKLPSFCW 194 >ref|XP_009771483.1| PREDICTED: uncharacterized protein At3g61260 [Nicotiana sylvestris] Length = 356 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 270 EKADYIRRTGHMPSSFSFKLPSFCW 196 EKADYIRRTGH+PSSFSFKLPSFCW Sbjct: 332 EKADYIRRTGHLPSSFSFKLPSFCW 356 >ref|XP_009591472.1| PREDICTED: uncharacterized protein At3g61260 [Nicotiana tomentosiformis] Length = 349 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 270 EKADYIRRTGHMPSSFSFKLPSFCW 196 EKADYIRRTGH+PSSFSFKLPSFCW Sbjct: 325 EKADYIRRTGHLPSSFSFKLPSFCW 349 >ref|XP_010250815.1| PREDICTED: uncharacterized protein LOC104592945 isoform X1 [Nelumbo nucifera] gi|719983638|ref|XP_010250816.1| PREDICTED: uncharacterized protein LOC104592945 isoform X1 [Nelumbo nucifera] gi|719983642|ref|XP_010250817.1| PREDICTED: uncharacterized protein LOC104592945 isoform X1 [Nelumbo nucifera] gi|719983645|ref|XP_010250818.1| PREDICTED: uncharacterized protein LOC104592945 isoform X1 [Nelumbo nucifera] Length = 385 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -2 Query: 270 EKADYIRRTGHMPSSFSFKLPSFCW*RLAKC 178 E+ADYIRRTGH+PSSFSFKLPS CW + +C Sbjct: 333 ERADYIRRTGHLPSSFSFKLPSLCWDKSTRC 363