BLASTX nr result
ID: Gardenia21_contig00017043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00017043 (638 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP17043.1| unnamed protein product [Coffea canephora] 86 2e-14 >emb|CDP17043.1| unnamed protein product [Coffea canephora] Length = 63 Score = 85.5 bits (210), Expect = 2e-14 Identities = 43/62 (69%), Positives = 47/62 (75%), Gaps = 1/62 (1%) Frame = -2 Query: 478 FLHESEKLPYEAEEIRDTRCFFIMLRGWTNFCCKL-PSSGTRRVEEWINMVCIHVQAHCV 302 FLH+SEKLPYEAEEIR R FF M GWTNFCC+L P SGT+RVE CI VQAHCV Sbjct: 5 FLHDSEKLPYEAEEIRGARSFFTMSCGWTNFCCELPPRSGTQRVEG-----CIQVQAHCV 59 Query: 301 IL 296 +L Sbjct: 60 LL 61