BLASTX nr result
ID: Gardenia21_contig00017025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00017025 (352 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010111972.1| Mannose-1-phosphate guanyltransferase alpha ... 57 7e-06 >ref|XP_010111972.1| Mannose-1-phosphate guanyltransferase alpha [Morus notabilis] gi|587945874|gb|EXC32246.1| Mannose-1-phosphate guanyltransferase alpha [Morus notabilis] Length = 443 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +2 Query: 254 GWLRGADMGSSEEKVVAVIMVGGPTKGTRFRPL 352 GW R MGS+EEKVVAVIMVGGPTKGTRFRPL Sbjct: 37 GWFR---MGSAEEKVVAVIMVGGPTKGTRFRPL 66