BLASTX nr result
ID: Gardenia21_contig00017022
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00017022 (339 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP07578.1| unnamed protein product [Coffea canephora] 74 6e-11 >emb|CDP07578.1| unnamed protein product [Coffea canephora] Length = 230 Score = 73.6 bits (179), Expect = 6e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 338 GSTSQAGDVSLTLGLRHPSSNLPRKRTGFSIRDFGAF 228 GSTSQAGDVSLTLGLRHPSSNLPRKRT FS+RDFGAF Sbjct: 194 GSTSQAGDVSLTLGLRHPSSNLPRKRTEFSLRDFGAF 230