BLASTX nr result
ID: Gardenia21_contig00016920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00016920 (501 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012065140.1| PREDICTED: cytochrome c oxidase assembly pro... 128 2e-27 ref|XP_010095969.1| Cytochrome c oxidase assembly protein COX11 ... 127 3e-27 ref|XP_007015809.1| Cytochrome c oxidase assembly protein CtaG /... 127 3e-27 ref|XP_007015808.1| Cytochrome c oxidase assembly protein CtaG /... 127 3e-27 ref|XP_007015807.1| Cytochrome c oxidase assembly protein CtaG /... 127 3e-27 emb|CDP01675.1| unnamed protein product [Coffea canephora] 127 4e-27 ref|XP_011026708.1| PREDICTED: cytochrome c oxidase assembly pro... 126 5e-27 ref|XP_009361928.1| PREDICTED: cytochrome c oxidase assembly pro... 126 5e-27 ref|XP_009355117.1| PREDICTED: cytochrome c oxidase assembly pro... 126 5e-27 ref|XP_008346526.1| PREDICTED: cytochrome c oxidase assembly pro... 126 5e-27 ref|XP_008244142.1| PREDICTED: cytochrome c oxidase assembly pro... 126 5e-27 ref|XP_011468937.1| PREDICTED: cytochrome c oxidase assembly pro... 126 5e-27 ref|XP_007202655.1| hypothetical protein PRUPE_ppa012273mg [Prun... 126 5e-27 gb|KNA26021.1| hypothetical protein SOVF_000090 [Spinacia oleracea] 126 7e-27 ref|XP_010274440.1| PREDICTED: cytochrome c oxidase assembly pro... 126 7e-27 ref|XP_010274439.1| PREDICTED: cytochrome c oxidase assembly pro... 126 7e-27 ref|XP_006348705.1| PREDICTED: cytochrome c oxidase assembly pro... 126 7e-27 ref|XP_004239062.1| PREDICTED: cytochrome c oxidase assembly pro... 126 7e-27 ref|XP_011085890.1| PREDICTED: cytochrome c oxidase assembly pro... 125 9e-27 ref|XP_010542835.1| PREDICTED: cytochrome c oxidase assembly pro... 125 9e-27 >ref|XP_012065140.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial [Jatropha curcas] gi|643741302|gb|KDP46796.1| hypothetical protein JCGZ_11167 [Jatropha curcas] Length = 265 Score = 128 bits (321), Expect = 2e-27 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDG+NN+ILSYTFFKVSDE Sbjct: 206 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSDE 265 >ref|XP_010095969.1| Cytochrome c oxidase assembly protein COX11 [Morus notabilis] gi|587873477|gb|EXB62662.1| Cytochrome c oxidase assembly protein COX11 [Morus notabilis] Length = 282 Score = 127 bits (319), Expect = 3e-27 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDG+NNLILSYTFFKVS+E Sbjct: 223 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 282 >ref|XP_007015809.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 3 [Theobroma cacao] gi|508786172|gb|EOY33428.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 3 [Theobroma cacao] Length = 279 Score = 127 bits (319), Expect = 3e-27 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDG+NNLILSYTFFKVS+E Sbjct: 220 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 279 >ref|XP_007015808.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 2 [Theobroma cacao] gi|508786171|gb|EOY33427.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 2 [Theobroma cacao] Length = 269 Score = 127 bits (319), Expect = 3e-27 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDG+NNLILSYTFFKVS+E Sbjct: 210 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 269 >ref|XP_007015807.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 1 [Theobroma cacao] gi|508786170|gb|EOY33426.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 1 [Theobroma cacao] Length = 278 Score = 127 bits (319), Expect = 3e-27 Identities = 58/60 (96%), Positives = 60/60 (100%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDG+NNLILSYTFFKVS+E Sbjct: 219 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 278 >emb|CDP01675.1| unnamed protein product [Coffea canephora] Length = 286 Score = 127 bits (318), Expect = 4e-27 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDG+NNLILSYTFFKV DE Sbjct: 227 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVPDE 286 >ref|XP_011026708.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X1 [Populus euphratica] Length = 250 Score = 126 bits (317), Expect = 5e-27 Identities = 57/60 (95%), Positives = 60/60 (100%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDG+NN+ILSYTFFKVS+E Sbjct: 191 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSEE 250 >ref|XP_009361928.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Pyrus x bretschneideri] Length = 277 Score = 126 bits (317), Expect = 5e-27 Identities = 57/60 (95%), Positives = 60/60 (100%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDG+NN+ILSYTFFKVS+E Sbjct: 218 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSEE 277 >ref|XP_009355117.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Pyrus x bretschneideri] gi|694328650|ref|XP_009355119.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Pyrus x bretschneideri] Length = 277 Score = 126 bits (317), Expect = 5e-27 Identities = 57/60 (95%), Positives = 60/60 (100%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDG+NN+ILSYTFFKVS+E Sbjct: 218 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSEE 277 >ref|XP_008346526.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial [Malus domestica] gi|657950173|ref|XP_008346534.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial [Malus domestica] gi|657950175|ref|XP_008346541.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial [Malus domestica] gi|658018263|ref|XP_008344480.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Malus domestica] gi|658018265|ref|XP_008344481.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Malus domestica] gi|658018267|ref|XP_008344482.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Malus domestica] Length = 277 Score = 126 bits (317), Expect = 5e-27 Identities = 57/60 (95%), Positives = 60/60 (100%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDG+NN+ILSYTFFKVS+E Sbjct: 218 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSEE 277 >ref|XP_008244142.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Prunus mume] gi|645278242|ref|XP_008244143.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Prunus mume] Length = 271 Score = 126 bits (317), Expect = 5e-27 Identities = 57/60 (95%), Positives = 60/60 (100%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDG+NN+ILSYTFFKVS+E Sbjct: 212 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSEE 271 >ref|XP_011468937.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial [Fragaria vesca subsp. vesca] Length = 266 Score = 126 bits (317), Expect = 5e-27 Identities = 57/60 (95%), Positives = 60/60 (100%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDG+NN+ILSYTFFKVS+E Sbjct: 207 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSEE 266 >ref|XP_007202655.1| hypothetical protein PRUPE_ppa012273mg [Prunus persica] gi|462398186|gb|EMJ03854.1| hypothetical protein PRUPE_ppa012273mg [Prunus persica] Length = 177 Score = 126 bits (317), Expect = 5e-27 Identities = 57/60 (95%), Positives = 60/60 (100%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDG+NN+ILSYTFFKVS+E Sbjct: 118 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSEE 177 >gb|KNA26021.1| hypothetical protein SOVF_000090 [Spinacia oleracea] Length = 271 Score = 126 bits (316), Expect = 7e-27 Identities = 56/60 (93%), Positives = 60/60 (100%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AAVYFNKIQCFCFEEQRLLPGEQ+DMPVFFYIDPEFETDPRMDG+NN+ILSYTFFKVS+E Sbjct: 212 AAVYFNKIQCFCFEEQRLLPGEQVDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSEE 271 >ref|XP_010274440.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X2 [Nelumbo nucifera] Length = 166 Score = 126 bits (316), Expect = 7e-27 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKV +E Sbjct: 107 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVGEE 166 >ref|XP_010274439.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial isoform X1 [Nelumbo nucifera] Length = 288 Score = 126 bits (316), Expect = 7e-27 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKV +E Sbjct: 229 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVGEE 288 >ref|XP_006348705.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like [Solanum tuberosum] Length = 287 Score = 126 bits (316), Expect = 7e-27 Identities = 57/60 (95%), Positives = 60/60 (100%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDG+NNLILSYTFFKVSD+ Sbjct: 228 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSDK 287 >ref|XP_004239062.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial [Solanum lycopersicum] Length = 287 Score = 126 bits (316), Expect = 7e-27 Identities = 57/60 (95%), Positives = 60/60 (100%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDG+NNLILSYTFFKVSD+ Sbjct: 228 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSDK 287 >ref|XP_011085890.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial [Sesamum indicum] Length = 275 Score = 125 bits (315), Expect = 9e-27 Identities = 56/60 (93%), Positives = 60/60 (100%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 AA+YFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDG+NNLILSYTFFKVS+E Sbjct: 215 AAIYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE 274 >ref|XP_010542835.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial [Tarenaya hassleriana] Length = 301 Score = 125 bits (315), Expect = 9e-27 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = -2 Query: 500 AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVSDE 321 A VYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDG+NNLILSYTFFKVS+E Sbjct: 224 AGVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE 283