BLASTX nr result
ID: Gardenia21_contig00016908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00016908 (225 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98474.1| unnamed protein product [Coffea canephora] 95 2e-17 >emb|CDO98474.1| unnamed protein product [Coffea canephora] Length = 1445 Score = 95.1 bits (235), Expect = 2e-17 Identities = 54/66 (81%), Positives = 56/66 (84%), Gaps = 3/66 (4%) Frame = -1 Query: 225 KAPPVDLYRKKGDPGSVASMQPNP-GETSGAKVVIKPLDS--DATQNSSSHRLKIKIKKR 55 KAPPV RKK D GS AS QPNP GETSGAKVVIKPLDS +ATQ+SSSHRLKIKIKKR Sbjct: 1380 KAPPVGSDRKKDDAGSGASAQPNPPGETSGAKVVIKPLDSSVNATQSSSSHRLKIKIKKR 1439 Query: 54 TLEKPS 37 TLEKPS Sbjct: 1440 TLEKPS 1445