BLASTX nr result
ID: Gardenia21_contig00016740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00016740 (289 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO46891.1| hypothetical protein CISIN_1g009680mg [Citrus sin... 62 1e-07 ref|XP_002867239.1| hypothetical protein ARALYDRAFT_491471 [Arab... 62 2e-07 ref|XP_012077319.1| PREDICTED: serine hydroxymethyltransferase 3... 62 2e-07 gb|KNA21153.1| hypothetical protein SOVF_045950 [Spinacia oleracea] 61 3e-07 ref|XP_012857883.1| PREDICTED: serine hydroxymethyltransferase 3... 61 3e-07 ref|XP_008451853.1| PREDICTED: serine hydroxymethyltransferase 3... 61 3e-07 gb|EYU20372.1| hypothetical protein MIMGU_mgv1a004404mg [Erythra... 61 3e-07 ref|XP_007012241.1| Serine hydroxymethyltransferase 3 isoform 1 ... 61 3e-07 ref|XP_011653260.1| PREDICTED: serine hydroxymethyltransferase 3... 61 3e-07 gb|AHB32114.1| serine hydroxymethyltransferase [Camellia sinensis] 61 4e-07 ref|XP_008353855.1| PREDICTED: serine hydroxymethyltransferase 3... 60 5e-07 gb|KDO46894.1| hypothetical protein CISIN_1g009680mg [Citrus sin... 60 5e-07 gb|KDO46890.1| hypothetical protein CISIN_1g009680mg [Citrus sin... 60 5e-07 gb|KDO46888.1| hypothetical protein CISIN_1g009680mg [Citrus sin... 60 5e-07 ref|XP_002519806.1| serine hydroxymethyltransferase, putative [R... 60 5e-07 ref|XP_006478527.1| PREDICTED: serine hydroxymethyltransferase 3... 60 5e-07 ref|XP_006441948.1| hypothetical protein CICLE_v10019689mg [Citr... 60 5e-07 ref|XP_010108405.1| Serine hydroxymethyltransferase [Morus notab... 60 6e-07 ref|XP_011081701.1| PREDICTED: serine hydroxymethyltransferase 3... 60 6e-07 ref|XP_009591252.1| PREDICTED: serine hydroxymethyltransferase 3... 60 6e-07 >gb|KDO46891.1| hypothetical protein CISIN_1g009680mg [Citrus sinensis] Length = 419 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPLVS 191 RALA RLVELGYKLVSGGSDNHLVLVDLRP+V+ Sbjct: 384 RALASRLVELGYKLVSGGSDNHLVLVDLRPMVT 416 >ref|XP_002867239.1| hypothetical protein ARALYDRAFT_491471 [Arabidopsis lyrata subsp. lyrata] gi|297313075|gb|EFH43498.1| hypothetical protein ARALYDRAFT_491471 [Arabidopsis lyrata subsp. lyrata] Length = 530 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPLVS 191 RALA RLVELG+KLVSGGSDNHLVLVDLRP+VS Sbjct: 384 RALANRLVELGFKLVSGGSDNHLVLVDLRPMVS 416 >ref|XP_012077319.1| PREDICTED: serine hydroxymethyltransferase 3, chloroplastic [Jatropha curcas] gi|802632462|ref|XP_012077320.1| PREDICTED: serine hydroxymethyltransferase 3, chloroplastic [Jatropha curcas] gi|643724919|gb|KDP34120.1| hypothetical protein JCGZ_07691 [Jatropha curcas] Length = 527 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPL 197 RALA+RLVELGYKLVSGGSDNHLVLVDLRPL Sbjct: 382 RALAKRLVELGYKLVSGGSDNHLVLVDLRPL 412 >gb|KNA21153.1| hypothetical protein SOVF_045950 [Spinacia oleracea] Length = 535 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPL 197 RALA RLVELGYKLVSGGSDNHLVLVDLRPL Sbjct: 390 RALASRLVELGYKLVSGGSDNHLVLVDLRPL 420 >ref|XP_012857883.1| PREDICTED: serine hydroxymethyltransferase 3, chloroplastic [Erythranthe guttatus] Length = 527 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPL 197 RALA RLVELGYKLVSGGSDNHLVLVDLRPL Sbjct: 382 RALASRLVELGYKLVSGGSDNHLVLVDLRPL 412 >ref|XP_008451853.1| PREDICTED: serine hydroxymethyltransferase 3, chloroplastic [Cucumis melo] Length = 528 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPL 197 RALA RLVELGYKLVSGGSDNHLVLVDLRPL Sbjct: 383 RALASRLVELGYKLVSGGSDNHLVLVDLRPL 413 >gb|EYU20372.1| hypothetical protein MIMGU_mgv1a004404mg [Erythranthe guttata] Length = 529 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPL 197 RALA RLVELGYKLVSGGSDNHLVLVDLRPL Sbjct: 384 RALASRLVELGYKLVSGGSDNHLVLVDLRPL 414 >ref|XP_007012241.1| Serine hydroxymethyltransferase 3 isoform 1 [Theobroma cacao] gi|508782604|gb|EOY29860.1| Serine hydroxymethyltransferase 3 isoform 1 [Theobroma cacao] Length = 523 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPL 197 RALA RLVELGYKLVSGGSDNHLVLVDLRPL Sbjct: 378 RALASRLVELGYKLVSGGSDNHLVLVDLRPL 408 >ref|XP_011653260.1| PREDICTED: serine hydroxymethyltransferase 3, chloroplastic [Cucumis sativus] gi|700198344|gb|KGN53502.1| hypothetical protein Csa_4G062380 [Cucumis sativus] Length = 528 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPL 197 RALA RLVELGYKLVSGGSDNHLVLVDLRPL Sbjct: 383 RALANRLVELGYKLVSGGSDNHLVLVDLRPL 413 >gb|AHB32114.1| serine hydroxymethyltransferase [Camellia sinensis] Length = 520 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPL 197 RALA RL+ELGYKLVSGGSDNHLVLVDLRPL Sbjct: 375 RALASRLIELGYKLVSGGSDNHLVLVDLRPL 405 >ref|XP_008353855.1| PREDICTED: serine hydroxymethyltransferase 3, chloroplastic-like [Malus domestica] Length = 95 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPLVS 191 RALA RL E GYKLVSGGSDNHLVLVDLRPLVS Sbjct: 62 RALASRLTERGYKLVSGGSDNHLVLVDLRPLVS 94 >gb|KDO46894.1| hypothetical protein CISIN_1g009680mg [Citrus sinensis] Length = 520 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPL 197 RALA RLVELGYKLVSGGSDNHLVLVDLRP+ Sbjct: 375 RALASRLVELGYKLVSGGSDNHLVLVDLRPM 405 >gb|KDO46890.1| hypothetical protein CISIN_1g009680mg [Citrus sinensis] Length = 447 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPL 197 RALA RLVELGYKLVSGGSDNHLVLVDLRP+ Sbjct: 302 RALASRLVELGYKLVSGGSDNHLVLVDLRPM 332 >gb|KDO46888.1| hypothetical protein CISIN_1g009680mg [Citrus sinensis] gi|641827713|gb|KDO46889.1| hypothetical protein CISIN_1g009680mg [Citrus sinensis] Length = 529 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPL 197 RALA RLVELGYKLVSGGSDNHLVLVDLRP+ Sbjct: 384 RALASRLVELGYKLVSGGSDNHLVLVDLRPM 414 >ref|XP_002519806.1| serine hydroxymethyltransferase, putative [Ricinus communis] gi|223541045|gb|EEF42602.1| serine hydroxymethyltransferase, putative [Ricinus communis] Length = 527 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPL 197 RALA RLVELGYKLVSGGSDNHLVLVDLRPL Sbjct: 382 RALAYRLVELGYKLVSGGSDNHLVLVDLRPL 412 >ref|XP_006478527.1| PREDICTED: serine hydroxymethyltransferase 3, chloroplastic-like [Citrus sinensis] Length = 529 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPL 197 RALA RLVELGYKLVSGGSDNHLVLVDLRP+ Sbjct: 384 RALASRLVELGYKLVSGGSDNHLVLVDLRPM 414 >ref|XP_006441948.1| hypothetical protein CICLE_v10019689mg [Citrus clementina] gi|557544210|gb|ESR55188.1| hypothetical protein CICLE_v10019689mg [Citrus clementina] Length = 529 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPL 197 RALA RLVELGYKLVSGGSDNHLVLVDLRP+ Sbjct: 384 RALASRLVELGYKLVSGGSDNHLVLVDLRPM 414 >ref|XP_010108405.1| Serine hydroxymethyltransferase [Morus notabilis] gi|587932345|gb|EXC19409.1| Serine hydroxymethyltransferase [Morus notabilis] Length = 517 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPL 197 RALA RL+ELGYKLVSGGSDNHLVLVDLRPL Sbjct: 372 RALASRLMELGYKLVSGGSDNHLVLVDLRPL 402 >ref|XP_011081701.1| PREDICTED: serine hydroxymethyltransferase 3, chloroplastic [Sesamum indicum] Length = 529 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPL 197 RALA RLV+LGYKLVSGGSDNHLVLVDLRPL Sbjct: 384 RALASRLVDLGYKLVSGGSDNHLVLVDLRPL 414 >ref|XP_009591252.1| PREDICTED: serine hydroxymethyltransferase 3, chloroplastic-like [Nicotiana tomentosiformis] gi|697164877|ref|XP_009591254.1| PREDICTED: serine hydroxymethyltransferase 3, chloroplastic-like [Nicotiana tomentosiformis] Length = 525 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 289 RALAERLVELGYKLVSGGSDNHLVLVDLRPL 197 RALA RL+ELGYKLVSGGSDNHLVLVDLRPL Sbjct: 380 RALASRLMELGYKLVSGGSDNHLVLVDLRPL 410