BLASTX nr result
ID: Gardenia21_contig00016609
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00016609 (377 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP09066.1| unnamed protein product [Coffea canephora] 110 8e-23 >emb|CDP09066.1| unnamed protein product [Coffea canephora] Length = 644 Score = 110 bits (274), Expect(2) = 8e-23 Identities = 60/68 (88%), Positives = 60/68 (88%), Gaps = 1/68 (1%) Frame = +3 Query: 141 SILPSEDNN-STRLKMVHLESEVDVSTSNLSAEDNVAAETTLVETELFNHPVGMDVMQIE 317 SILPSEDNN STRLKMVH ESEVDVSTSNLSAEDNVAAETTLV EL NHPVGMDVM E Sbjct: 14 SILPSEDNNNSTRLKMVHQESEVDVSTSNLSAEDNVAAETTLVGAELSNHPVGMDVMPTE 73 Query: 318 IVPQSEPK 341 IVPQSE K Sbjct: 74 IVPQSEHK 81 Score = 23.5 bits (49), Expect(2) = 8e-23 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 95 MPRSATCFGSW 127 MPRSA CF W Sbjct: 1 MPRSANCFRGW 11