BLASTX nr result
ID: Gardenia21_contig00016505
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00016505 (561 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP19795.1| unnamed protein product [Coffea canephora] 58 3e-08 >emb|CDP19795.1| unnamed protein product [Coffea canephora] Length = 102 Score = 58.2 bits (139), Expect(2) = 3e-08 Identities = 34/58 (58%), Positives = 37/58 (63%), Gaps = 4/58 (6%) Frame = -2 Query: 302 KLDLEDSSDNHSENKSDAYSAMEEIQRFGAD----EMQEFLCPHSLVQGRTAATSCKS 141 K EDSS+NHS+ KS A S MEEIQR A MQ FL P S VQGRTAA SC + Sbjct: 27 KRRFEDSSNNHSKRKSKACSGMEEIQRLCAARICIHMQGFLSPRSKVQGRTAARSCNA 84 Score = 26.6 bits (57), Expect(2) = 3e-08 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 136 LN*TIYYSLPPKSKRDS 86 LN T+ Y+ PPK+KRDS Sbjct: 86 LNWTMDYTFPPKNKRDS 102