BLASTX nr result
ID: Gardenia21_contig00014403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00014403 (720 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_358628.1| hypothetical protein PhapfoPp082 [Phalaenopsis ... 68 5e-09 >ref|YP_358628.1| hypothetical protein PhapfoPp082 [Phalaenopsis aphrodite subsp. formosana] gi|58802845|gb|AAW82565.1| hypothetical protein [Phalaenopsis aphrodite subsp. formosana] Length = 81 Score = 68.2 bits (165), Expect = 5e-09 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -3 Query: 550 TFEVTERKATTGVGESESKRGFITSFFH*KPCMRLPSHTA 431 TFEVTERKATTGVGESESKRGF+TS H KPCMRL TA Sbjct: 40 TFEVTERKATTGVGESESKRGFLTSLSHSKPCMRLSPRTA 79