BLASTX nr result
ID: Gardenia21_contig00014284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00014284 (1007 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP04214.1| unnamed protein product [Coffea canephora] 70 4e-14 >emb|CDP04214.1| unnamed protein product [Coffea canephora] Length = 77 Score = 70.5 bits (171), Expect(2) = 4e-14 Identities = 35/51 (68%), Positives = 39/51 (76%) Frame = -3 Query: 384 MNKRSPWWSFSSGNETTAQCPGSLPFPGLQSHSCS*CIDLHQTLRLLNFFF 232 M+KRS WWSF+SG++TT Q GS FPGLQ SCS CID HQTLRLLN F Sbjct: 1 MDKRSSWWSFNSGHKTTDQYTGSSLFPGLQ--SCSGCIDQHQTLRLLNLLF 49 Score = 36.2 bits (82), Expect(2) = 4e-14 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -2 Query: 202 ECHSLLFPVLLGFIFCLV 149 ECHSLL PVLLG IFC++ Sbjct: 60 ECHSLLVPVLLGLIFCMI 77