BLASTX nr result
ID: Gardenia21_contig00012352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00012352 (342 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13682.1| unnamed protein product [Coffea canephora] 44 4e-06 >emb|CDP13682.1| unnamed protein product [Coffea canephora] Length = 957 Score = 43.9 bits (102), Expect(2) = 4e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -2 Query: 341 NSPSSSGGFRQFSSKGLIFVE 279 NSPSSSGGFRQFSSKGLIFV+ Sbjct: 54 NSPSSSGGFRQFSSKGLIFVQ 74 Score = 33.1 bits (74), Expect(2) = 4e-06 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 4/33 (12%) Frame = -1 Query: 216 LFVPQKNLFSDCRMA----VVLGHSIGHQITPG 130 LFVPQKNLFSDC+ A V+LG ++ G Sbjct: 77 LFVPQKNLFSDCKQAENPLVLLGQYSDDELDDG 109