BLASTX nr result
ID: Gardenia21_contig00012340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00012340 (566 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP10686.1| unnamed protein product [Coffea canephora] 39 5e-08 >emb|CDP10686.1| unnamed protein product [Coffea canephora] Length = 506 Score = 38.5 bits (88), Expect(3) = 5e-08 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = -3 Query: 453 RRLEFLFPEVIPKCSIQHLKETEILEFD*K 364 + E LFPE +PK SI+HLKE E +FD K Sbjct: 413 KEFELLFPEFMPKYSIEHLKEIEFTKFDEK 442 Score = 32.3 bits (72), Expect(3) = 5e-08 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = -2 Query: 367 EEYECKRVEYLLPNGGALRKMKL*QGLQ 284 + YE K VEYLL NG AL+KM L LQ Sbjct: 442 KRYEFKLVEYLLQNGKALKKMVLRGSLQ 469 Score = 32.3 bits (72), Expect(3) = 5e-08 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -1 Query: 293 RPSSCKRIMSYKRCYADSKIVAEE 222 +PSS RIMSY RC D +IV EE Sbjct: 469 QPSSYDRIMSYMRCSEDCQIVVEE 492