BLASTX nr result
ID: Gardenia21_contig00012239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00012239 (216 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO99621.1| unnamed protein product [Coffea canephora] 95 2e-17 >emb|CDO99621.1| unnamed protein product [Coffea canephora] Length = 452 Score = 95.1 bits (235), Expect = 2e-17 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -2 Query: 215 PNLSMYNAGPMAPVGGISAAGMGRPYSTMSAPSNYDFSPLVQGMFTKR 72 PNLSMYNA PMAPVGGISAAGMGRPYST+SAPSNYDFS LVQGMFTKR Sbjct: 405 PNLSMYNATPMAPVGGISAAGMGRPYSTLSAPSNYDFSSLVQGMFTKR 452