BLASTX nr result
ID: Gardenia21_contig00012183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00012183 (863 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP15541.1| unnamed protein product [Coffea canephora] 62 6e-07 >emb|CDP15541.1| unnamed protein product [Coffea canephora] Length = 120 Score = 62.0 bits (149), Expect = 6e-07 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = +3 Query: 723 VGNMMNTQGAFLVIGVALATISTSLQAAQIPGPLPATFYAFYLALEL 863 + + MN Q FLVIGV+ I+TSLQAAQIPG LPA F+ FYLALEL Sbjct: 1 MADTMNVQWVFLVIGVSFVAINTSLQAAQIPGSLPAIFHWFYLALEL 47