BLASTX nr result
ID: Gardenia21_contig00012124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00012124 (257 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP12492.1| unnamed protein product [Coffea canephora] 79 1e-12 >emb|CDP12492.1| unnamed protein product [Coffea canephora] Length = 422 Score = 79.3 bits (194), Expect = 1e-12 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -1 Query: 134 METLLSLSTPLRINTLHPMVSPSFLQRSGSAYKFLPVKRLLQGK 3 METLL LST LRINTLHPMVSPSFLQRSGSA KFLP+KRLLQGK Sbjct: 1 METLLPLSTTLRINTLHPMVSPSFLQRSGSANKFLPLKRLLQGK 44