BLASTX nr result
ID: Gardenia21_contig00012059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00012059 (329 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98950.1| unnamed protein product [Coffea canephora] 103 7e-20 ref|XP_009604215.1| PREDICTED: uncharacterized protein LOC104099... 57 7e-06 >emb|CDO98950.1| unnamed protein product [Coffea canephora] Length = 245 Score = 103 bits (256), Expect = 7e-20 Identities = 49/64 (76%), Positives = 52/64 (81%), Gaps = 4/64 (6%) Frame = -3 Query: 237 MGTEVLRPQDVFYDRFRLSPPVFHHRRRTYSANGNGFGNPRSNNNSGHRKPVHR----DH 70 MGTEVLRPQDVFYDRFRLSPP FHHRR+ Y ANGN FGNPR NNSGH++PV R D Sbjct: 1 MGTEVLRPQDVFYDRFRLSPPAFHHRRKNYFANGNAFGNPRPINNSGHKRPVPRLERSDL 60 Query: 69 KRKT 58 KRKT Sbjct: 61 KRKT 64 >ref|XP_009604215.1| PREDICTED: uncharacterized protein LOC104099045 [Nicotiana tomentosiformis] Length = 163 Score = 56.6 bits (135), Expect = 7e-06 Identities = 30/59 (50%), Positives = 38/59 (64%) Frame = -3 Query: 237 MGTEVLRPQDVFYDRFRLSPPVFHHRRRTYSANGNGFGNPRSNNNSGHRKPVHRDHKRK 61 MGTE+LRPQD+ +RFR+ P F HRRR+ N NG+ NPR +RK V R K+K Sbjct: 1 MGTEILRPQDILIERFRVPPSAF-HRRRSNFGNENGYFNPR------NRKSVVRTEKKK 52