BLASTX nr result
ID: Gardenia21_contig00010997
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00010997 (671 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03541.1| unnamed protein product [Coffea canephora] 88 4e-15 ref|XP_011079733.1| PREDICTED: RING finger and CHY zinc finger d... 82 2e-13 ref|XP_009587771.1| PREDICTED: RING finger and CHY zinc finger d... 82 4e-13 ref|XP_009769467.1| PREDICTED: RING finger and CHY zinc finger d... 80 1e-12 ref|XP_010323027.1| PREDICTED: RING finger and CHY zinc finger d... 79 2e-12 ref|XP_012833440.1| PREDICTED: RING finger and CHY zinc finger d... 76 2e-11 ref|XP_009378904.1| PREDICTED: RING finger and CHY zinc finger d... 69 3e-09 ref|XP_010545043.1| PREDICTED: RING finger and CHY zinc finger d... 67 8e-09 ref|XP_008375844.1| PREDICTED: RING finger and CHY zinc finger d... 66 2e-08 ref|XP_010241530.1| PREDICTED: RING finger and CHY zinc finger d... 66 2e-08 ref|XP_002268410.1| PREDICTED: RING finger and CHY zinc finger d... 64 6e-08 ref|XP_009803954.1| PREDICTED: RING finger and CHY zinc finger d... 64 1e-07 ref|XP_009803952.1| PREDICTED: RING finger and CHY zinc finger d... 64 1e-07 ref|XP_004241068.1| PREDICTED: RING finger and CHY zinc finger d... 64 1e-07 ref|XP_012473996.1| PREDICTED: RING finger and CHY zinc finger d... 63 1e-07 ref|XP_012473994.1| PREDICTED: RING finger and CHY zinc finger d... 63 1e-07 ref|XP_012473991.1| PREDICTED: RING finger and CHY zinc finger d... 63 1e-07 gb|KJB23199.1| hypothetical protein B456_004G086200 [Gossypium r... 63 1e-07 ref|XP_012473990.1| PREDICTED: RING finger and CHY zinc finger d... 63 1e-07 gb|KJB23192.1| hypothetical protein B456_004G086200 [Gossypium r... 63 1e-07 >emb|CDP03541.1| unnamed protein product [Coffea canephora] Length = 293 Score = 88.2 bits (217), Expect = 4e-15 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 671 VPILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMITTGENHQ 549 V ILCNDCNNT +A FHI+GHKCRHCNSYNTRMITTGENHQ Sbjct: 253 VSILCNDCNNTGKALFHIFGHKCRHCNSYNTRMITTGENHQ 293 >ref|XP_011079733.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Sesamum indicum] Length = 282 Score = 82.4 bits (202), Expect = 2e-13 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = -1 Query: 671 VPILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMITTGENHQ 549 V ILCNDCNN S+AFFHI+GHKC+HCNSYNTR+IT+GEN+Q Sbjct: 241 VQILCNDCNNRSKAFFHIFGHKCQHCNSYNTRVITSGENNQ 281 >ref|XP_009587771.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Nicotiana tomentosiformis] Length = 287 Score = 81.6 bits (200), Expect = 4e-13 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -1 Query: 671 VPILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMITTGENHQ 549 VPILCNDCN+T RAFFHI GHKC+HCNSYNTRMI TGE+ Q Sbjct: 247 VPILCNDCNSTGRAFFHILGHKCKHCNSYNTRMIGTGEDPQ 287 >ref|XP_009769467.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Nicotiana sylvestris] Length = 287 Score = 80.1 bits (196), Expect = 1e-12 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -1 Query: 671 VPILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMITTGENHQ 549 VPILCNDCN T RAFFHI GHKC+HCNSYNTRMI TGE+ Q Sbjct: 247 VPILCNDCNCTGRAFFHILGHKCKHCNSYNTRMIGTGEDPQ 287 >ref|XP_010323027.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Solanum lycopersicum] Length = 280 Score = 79.3 bits (194), Expect = 2e-12 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 671 VPILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMITTGEN 555 VPILCNDCN+T +AFFHI GHKC+HCNSYNTRMI TGE+ Sbjct: 240 VPILCNDCNSTGKAFFHILGHKCKHCNSYNTRMIGTGED 278 >ref|XP_012833440.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Erythranthe guttatus] gi|604348557|gb|EYU46712.1| hypothetical protein MIMGU_mgv1a011426mg [Erythranthe guttata] Length = 282 Score = 76.3 bits (186), Expect = 2e-11 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -1 Query: 671 VPILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMITTGENHQ 549 V ILCNDCN +S+A FHI+GHKC+ CNSYNTR+IT+GENHQ Sbjct: 241 VQILCNDCNKSSKASFHIFGHKCQLCNSYNTRVITSGENHQ 281 >ref|XP_009378904.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 isoform X1 [Pyrus x bretschneideri] Length = 272 Score = 68.9 bits (167), Expect = 3e-09 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 671 VPILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMITTGENHQ 549 V ILCNDCN TS+A FHI+GHKC +CNSYNTR+I NHQ Sbjct: 232 VSILCNDCNTTSKAPFHIFGHKCGNCNSYNTRVIDRPTNHQ 272 >ref|XP_010545043.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Tarenaya hassleriana] Length = 276 Score = 67.4 bits (163), Expect = 8e-09 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -1 Query: 671 VPILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMITTGENH 552 VPILCNDCN SR FHI GHKC HC SYNTR I+T +++ Sbjct: 230 VPILCNDCNQRSRVMFHILGHKCEHCGSYNTRRISTPQDN 269 >ref|XP_008375844.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Malus domestica] Length = 272 Score = 66.2 bits (160), Expect = 2e-08 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -1 Query: 671 VPILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMITTGENHQ 549 V ILCNDCN TS A FHI+GHKC +C+SYNTR+I NHQ Sbjct: 232 VSILCNDCNTTSNAPFHIFGHKCGNCHSYNTRVIDRPTNHQ 272 >ref|XP_010241530.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Nelumbo nucifera] Length = 267 Score = 65.9 bits (159), Expect = 2e-08 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 665 ILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMIT 567 ILCNDCN+T+ FFHI GHKC HCNSYNTRMI+ Sbjct: 229 ILCNDCNDTTETFFHIIGHKCCHCNSYNTRMIS 261 >ref|XP_002268410.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Vitis vinifera] gi|296086625|emb|CBI32260.3| unnamed protein product [Vitis vinifera] Length = 268 Score = 64.3 bits (155), Expect = 6e-08 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -1 Query: 665 ILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMITTGENHQ 549 ILCNDCN T + F+HI GHKC CNSYNTR I E+H+ Sbjct: 230 ILCNDCNKTCKVFYHILGHKCSSCNSYNTRKIAAPEDHE 268 >ref|XP_009803954.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform X2 [Nicotiana sylvestris] Length = 220 Score = 63.5 bits (153), Expect = 1e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 665 ILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMIT 567 ILCNDCN+T+ FFHI G KCRHC SYNTRMI+ Sbjct: 182 ILCNDCNDTTEVFFHIIGQKCRHCQSYNTRMIS 214 >ref|XP_009803952.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform X1 [Nicotiana sylvestris] Length = 267 Score = 63.5 bits (153), Expect = 1e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 665 ILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMIT 567 ILCNDCN+T+ FFHI G KCRHC SYNTRMI+ Sbjct: 229 ILCNDCNDTTEVFFHIIGQKCRHCQSYNTRMIS 261 >ref|XP_004241068.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Solanum lycopersicum] Length = 267 Score = 63.5 bits (153), Expect = 1e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -1 Query: 665 ILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMITT 564 ILCNDCN+T+ FFHI G KCRHC SYNTRMI + Sbjct: 229 ILCNDCNDTTEVFFHIIGQKCRHCESYNTRMIAS 262 >ref|XP_012473996.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 isoform X7 [Gossypium raimondii] Length = 216 Score = 63.2 bits (152), Expect = 1e-07 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -1 Query: 671 VPILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMITTGENH 552 V ILCNDCN+TS FH+ G KCR CNSYNTR IT NH Sbjct: 177 VSILCNDCNSTSMVQFHVLGLKCRQCNSYNTRRITAPANH 216 >ref|XP_012473994.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 isoform X5 [Gossypium raimondii] Length = 256 Score = 63.2 bits (152), Expect = 1e-07 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -1 Query: 671 VPILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMITTGENH 552 V ILCNDCN+TS FH+ G KCR CNSYNTR IT NH Sbjct: 217 VSILCNDCNSTSMVQFHVLGLKCRQCNSYNTRRITAPANH 256 >ref|XP_012473991.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 isoform X3 [Gossypium raimondii] Length = 259 Score = 63.2 bits (152), Expect = 1e-07 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -1 Query: 671 VPILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMITTGENH 552 V ILCNDCN+TS FH+ G KCR CNSYNTR IT NH Sbjct: 220 VSILCNDCNSTSMVQFHVLGLKCRQCNSYNTRRITAPANH 259 >gb|KJB23199.1| hypothetical protein B456_004G086200 [Gossypium raimondii] Length = 215 Score = 63.2 bits (152), Expect = 1e-07 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -1 Query: 671 VPILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMITTGENH 552 V ILCNDCN+TS FH+ G KCR CNSYNTR IT NH Sbjct: 176 VSILCNDCNSTSMVQFHVLGLKCRQCNSYNTRRITAPANH 215 >ref|XP_012473990.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 isoform X2 [Gossypium raimondii] gi|763755863|gb|KJB23194.1| hypothetical protein B456_004G086200 [Gossypium raimondii] Length = 269 Score = 63.2 bits (152), Expect = 1e-07 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -1 Query: 671 VPILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMITTGENH 552 V ILCNDCN+TS FH+ G KCR CNSYNTR IT NH Sbjct: 230 VSILCNDCNSTSMVQFHVLGLKCRQCNSYNTRRITAPANH 269 >gb|KJB23192.1| hypothetical protein B456_004G086200 [Gossypium raimondii] Length = 256 Score = 63.2 bits (152), Expect = 1e-07 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -1 Query: 671 VPILCNDCNNTSRAFFHIYGHKCRHCNSYNTRMITTGENH 552 V ILCNDCN+TS FH+ G KCR CNSYNTR IT NH Sbjct: 217 VSILCNDCNSTSMVQFHVLGLKCRQCNSYNTRRITAPANH 256