BLASTX nr result
ID: Gardenia21_contig00010961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00010961 (858 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010092630.1| hypothetical protein L484_006392 [Morus nota... 55 4e-06 ref|XP_003608224.1| calmodulin-binding protein [Medicago truncat... 55 4e-06 ref|XP_007159256.1| hypothetical protein PHAVU_002G222600g [Phas... 57 8e-06 >ref|XP_010092630.1| hypothetical protein L484_006392 [Morus notabilis] gi|587861996|gb|EXB51819.1| hypothetical protein L484_006392 [Morus notabilis] Length = 650 Score = 55.5 bits (132), Expect(2) = 4e-06 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 614 RPALASVIVEALKVDSLQKLCSSLEPILQ 700 RPALASVIVEALKVDSLQKLCSSLEPIL+ Sbjct: 54 RPALASVIVEALKVDSLQKLCSSLEPILR 82 Score = 23.5 bits (49), Expect(2) = 4e-06 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Frame = +1 Query: 556 IVREK--CSSISCEDSQPDRRK 615 +VREK S S E+ QPDR++ Sbjct: 33 VVREKRGLDSASAEEGQPDRKR 54 >ref|XP_003608224.1| calmodulin-binding protein [Medicago truncatula] gi|355509279|gb|AES90421.1| calmodulin-binding protein [Medicago truncatula] Length = 629 Score = 54.7 bits (130), Expect(2) = 4e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +2 Query: 614 RPALASVIVEALKVDSLQKLCSSLEPILQ 700 RPALASVIVEALKVDS+QKLCSSLEPIL+ Sbjct: 32 RPALASVIVEALKVDSMQKLCSSLEPILR 60 Score = 24.3 bits (51), Expect(2) = 4e-06 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 547 VMRIVREKCSSISCEDSQPDRRK 615 V R + S S ED QPDR++ Sbjct: 10 VARAEKRSLDSTSAEDGQPDRKR 32 >ref|XP_007159256.1| hypothetical protein PHAVU_002G222600g [Phaseolus vulgaris] gi|561032671|gb|ESW31250.1| hypothetical protein PHAVU_002G222600g [Phaseolus vulgaris] Length = 628 Score = 57.0 bits (136), Expect(2) = 8e-06 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +2 Query: 614 RPALASVIVEALKVDSLQKLCSSLEPILQSTFTNSTILA 730 RPALASVIVEALKVDSLQKLCSSLEPIL+ + LA Sbjct: 33 RPALASVIVEALKVDSLQKLCSSLEPILRRVVSEEVELA 71 Score = 20.8 bits (42), Expect(2) = 8e-06 Identities = 10/20 (50%), Positives = 13/20 (65%), Gaps = 2/20 (10%) Frame = +1 Query: 562 REK--CSSISCEDSQPDRRK 615 REK S S E+ QPDR++ Sbjct: 14 REKRGLDSASAEEGQPDRKR 33