BLASTX nr result
ID: Gardenia21_contig00010921
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00010921 (341 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP07083.1| unnamed protein product [Coffea canephora] 69 1e-09 emb|CDP07082.1| unnamed protein product [Coffea canephora] 69 1e-09 >emb|CDP07083.1| unnamed protein product [Coffea canephora] Length = 856 Score = 69.3 bits (168), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 90 METGNFRPELHVAQQSRRDKLRVQHHPNPC 1 METGNFRPELHVAQQSRRDKLRVQHHPNPC Sbjct: 1 METGNFRPELHVAQQSRRDKLRVQHHPNPC 30 >emb|CDP07082.1| unnamed protein product [Coffea canephora] Length = 130 Score = 69.3 bits (168), Expect = 1e-09 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 341 SRLKIYRNLAGIVILSMLHRGFSQYQDLVPSPTFIVSSFFE 219 SRLKI+RNLAGIVILS + +G S+YQDLVPSPTFIVSSFFE Sbjct: 68 SRLKIHRNLAGIVILSTVQKGSSRYQDLVPSPTFIVSSFFE 108