BLASTX nr result
ID: Gardenia21_contig00010900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00010900 (245 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP16220.1| unnamed protein product [Coffea canephora] 67 2e-19 >emb|CDP16220.1| unnamed protein product [Coffea canephora] Length = 437 Score = 67.4 bits (163), Expect(2) = 2e-19 Identities = 32/44 (72%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = -1 Query: 158 GALLELMSFWFFSI-TPKKWPFSILRRFLMFPRCSRTCNIAVVE 30 GALLELMSF F + TP+KWPFS+LRR LMFPRCS+ C IA+VE Sbjct: 394 GALLELMSFQFVTTKTPEKWPFSMLRRLLMFPRCSKACKIALVE 437 Score = 54.7 bits (130), Expect(2) = 2e-19 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -3 Query: 243 LCLAQKLRKVEVFDFVDSETQFNMVEY 163 LCLAQKLRKV++FDFVDSETQFN+VEY Sbjct: 363 LCLAQKLRKVDIFDFVDSETQFNVVEY 389