BLASTX nr result
ID: Gardenia21_contig00010757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00010757 (432 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP15211.1| unnamed protein product [Coffea canephora] 96 1e-17 emb|CDP15209.1| unnamed protein product [Coffea canephora] 94 5e-17 ref|XP_010026184.1| PREDICTED: pleiotropic drug resistance prote... 59 2e-06 >emb|CDP15211.1| unnamed protein product [Coffea canephora] Length = 1449 Score = 95.5 bits (236), Expect = 1e-17 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +2 Query: 5 IDTRPNKLPPGVEVTDDSGVERWIEDICIDMERRELGIPVEPVFLVFEDLSFTR 166 +DTRP LPPGV+VTDD GVERWIEDI IDMERRELGIPVEPV +FEDLSFTR Sbjct: 836 MDTRPTILPPGVKVTDDRGVERWIEDIAIDMERRELGIPVEPVSFMFEDLSFTR 889 >emb|CDP15209.1| unnamed protein product [Coffea canephora] Length = 1424 Score = 93.6 bits (231), Expect = 5e-17 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = +2 Query: 5 IDTRPNKLPPGVEVTDDSGVERWIEDICIDMERRELGIPVEPVFLVFEDLSFT 163 +DTRP LPPGV+VTDD GVERWIEDI IDMERRELGIPV+PV L+FEDLSFT Sbjct: 758 MDTRPTILPPGVKVTDDRGVERWIEDIAIDMERRELGIPVKPVSLMFEDLSFT 810 >ref|XP_010026184.1| PREDICTED: pleiotropic drug resistance protein 1-like [Eucalyptus grandis] Length = 1521 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/42 (57%), Positives = 33/42 (78%) Frame = +2 Query: 41 EVTDDSGVERWIEDICIDMERRELGIPVEPVFLVFEDLSFTR 166 ++ D+ GVE+W E+ +DMER LGIPVEP+ L+FEDL+F R Sbjct: 953 KIRDNGGVEKWTEEFMVDMERNGLGIPVEPITLLFEDLAFMR 994