BLASTX nr result
ID: Gardenia21_contig00010639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00010639 (462 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP18986.1| unnamed protein product [Coffea canephora] 67 4e-09 ref|XP_011086887.1| PREDICTED: uncharacterized protein LOC105168... 64 6e-08 ref|XP_010250513.1| PREDICTED: uncharacterized protein LOC104592... 62 2e-07 ref|XP_002512670.1| conserved hypothetical protein [Ricinus comm... 62 2e-07 ref|XP_010100028.1| hypothetical protein L484_013139 [Morus nota... 62 2e-07 ref|XP_010549312.1| PREDICTED: uncharacterized protein LOC104820... 62 2e-07 ref|XP_010549311.1| PREDICTED: uncharacterized protein LOC104820... 62 2e-07 ref|XP_009594259.1| PREDICTED: uncharacterized protein LOC104090... 62 2e-07 ref|XP_002270985.1| PREDICTED: uncharacterized protein LOC100245... 62 2e-07 ref|XP_004310142.1| PREDICTED: uncharacterized protein LOC101303... 61 3e-07 ref|XP_011029343.1| PREDICTED: uncharacterized protein LOC105129... 61 4e-07 ref|XP_002299513.1| hypothetical protein POPTR_0001s09760g [Popu... 61 4e-07 ref|XP_013711287.1| PREDICTED: uncharacterized protein LOC106415... 60 5e-07 ref|XP_013583623.1| PREDICTED: uncharacterized protein LOC106292... 60 5e-07 ref|XP_012452211.1| PREDICTED: uncharacterized protein LOC105774... 60 5e-07 gb|KHG11957.1| Perilipin-3 [Gossypium arboreum] 60 5e-07 ref|XP_007142588.1| hypothetical protein PHAVU_007G000300g [Phas... 60 5e-07 ref|XP_009802414.1| PREDICTED: uncharacterized protein LOC104247... 60 6e-07 ref|XP_007043780.1| F3H9.20 protein [Theobroma cacao] gi|5087077... 60 6e-07 ref|XP_003592175.1| integral membrane protein [Medicago truncatu... 60 6e-07 >emb|CDP18986.1| unnamed protein product [Coffea canephora] Length = 307 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -2 Query: 461 TLIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 TL+DYVIENPTAIWFVGPLFAALTGLVFKEG+ Sbjct: 190 TLVDYVIENPTAIWFVGPLFAALTGLVFKEGL 221 >ref|XP_011086887.1| PREDICTED: uncharacterized protein LOC105168483 [Sesamum indicum] Length = 288 Score = 63.5 bits (153), Expect = 6e-08 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -2 Query: 461 TLIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 +L++YV+ENPTA+WFVGPLFAALTGLVFKEG+ Sbjct: 166 SLVEYVVENPTAVWFVGPLFAALTGLVFKEGL 197 >ref|XP_010250513.1| PREDICTED: uncharacterized protein LOC104592744 [Nelumbo nucifera] Length = 308 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -2 Query: 461 TLIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 +L +YV+ENPTA+WFVGPLFAALTGLVFKEG+ Sbjct: 187 SLAEYVVENPTAVWFVGPLFAALTGLVFKEGL 218 >ref|XP_002512670.1| conserved hypothetical protein [Ricinus communis] gi|223548631|gb|EEF50122.1| conserved hypothetical protein [Ricinus communis] Length = 280 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 458 LIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 LI YVI+NPTA+WFVGPLFAALTGLVFKEG+ Sbjct: 163 LIQYVIDNPTAVWFVGPLFAALTGLVFKEGL 193 >ref|XP_010100028.1| hypothetical protein L484_013139 [Morus notabilis] gi|587892624|gb|EXB81199.1| hypothetical protein L484_013139 [Morus notabilis] Length = 326 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 458 LIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 L+ YV++NPTAIWFVGPLFAALTGLVFKEG+ Sbjct: 205 LVQYVVDNPTAIWFVGPLFAALTGLVFKEGL 235 >ref|XP_010549312.1| PREDICTED: uncharacterized protein LOC104820536 isoform X2 [Tarenaya hassleriana] Length = 264 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -2 Query: 461 TLIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 +L+ YV++NPTA+WFVGPLFAALTGLVFKEG+ Sbjct: 192 SLVQYVVDNPTAVWFVGPLFAALTGLVFKEGL 223 >ref|XP_010549311.1| PREDICTED: uncharacterized protein LOC104820536 isoform X1 [Tarenaya hassleriana] Length = 280 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -2 Query: 461 TLIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 +L+ YV++NPTA+WFVGPLFAALTGLVFKEG+ Sbjct: 162 SLVQYVVDNPTAVWFVGPLFAALTGLVFKEGL 193 >ref|XP_009594259.1| PREDICTED: uncharacterized protein LOC104090781 [Nicotiana tomentosiformis] gi|697101075|ref|XP_009594267.1| PREDICTED: uncharacterized protein LOC104090781 [Nicotiana tomentosiformis] Length = 291 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 461 TLIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 TL+ YVIEN TA+WFVGPLFAALTGLVFKEG+ Sbjct: 169 TLVQYVIENQTAVWFVGPLFAALTGLVFKEGL 200 >ref|XP_002270985.1| PREDICTED: uncharacterized protein LOC100245345 [Vitis vinifera] gi|296085529|emb|CBI29261.3| unnamed protein product [Vitis vinifera] Length = 290 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 458 LIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 LI YVI+NPTA+WF+GPLFAALTGLVFKEG+ Sbjct: 170 LIQYVIDNPTAVWFIGPLFAALTGLVFKEGL 200 >ref|XP_004310142.1| PREDICTED: uncharacterized protein LOC101303873 [Fragaria vesca subsp. vesca] Length = 285 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 458 LIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 L+ YV++NPTA+WFVGPLFAALTGLVFKEG+ Sbjct: 164 LVQYVVDNPTAVWFVGPLFAALTGLVFKEGL 194 >ref|XP_011029343.1| PREDICTED: uncharacterized protein LOC105129096 [Populus euphratica] Length = 281 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 458 LIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 LI YV+ NPTA+WFVGPLFAALTGLVFKEG+ Sbjct: 161 LIQYVVNNPTAVWFVGPLFAALTGLVFKEGL 191 >ref|XP_002299513.1| hypothetical protein POPTR_0001s09760g [Populus trichocarpa] gi|222846771|gb|EEE84318.1| hypothetical protein POPTR_0001s09760g [Populus trichocarpa] Length = 276 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 458 LIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 LI YV+ NPTA+WFVGPLFAALTGLVFKEG+ Sbjct: 161 LIQYVVNNPTAVWFVGPLFAALTGLVFKEGL 191 >ref|XP_013711287.1| PREDICTED: uncharacterized protein LOC106415195 [Brassica napus] Length = 304 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = -2 Query: 461 TLIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 +L+ YV++NPTA+WFVGPLFA+LTGLVFKEG+ Sbjct: 186 SLVQYVVDNPTAVWFVGPLFASLTGLVFKEGL 217 >ref|XP_013583623.1| PREDICTED: uncharacterized protein LOC106292557 [Brassica oleracea var. oleracea] Length = 304 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = -2 Query: 461 TLIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 +L+ YV++NPTA+WFVGPLFA+LTGLVFKEG+ Sbjct: 186 SLVQYVVDNPTAVWFVGPLFASLTGLVFKEGL 217 >ref|XP_012452211.1| PREDICTED: uncharacterized protein LOC105774304 [Gossypium raimondii] gi|763745053|gb|KJB12492.1| hypothetical protein B456_002G021400 [Gossypium raimondii] Length = 300 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 458 LIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 L+ YVIENP A+WFVGPLFAALTGLVFKEG+ Sbjct: 178 LVQYVIENPMAVWFVGPLFAALTGLVFKEGL 208 >gb|KHG11957.1| Perilipin-3 [Gossypium arboreum] Length = 300 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 458 LIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 L+ YVIENP A+WFVGPLFAALTGLVFKEG+ Sbjct: 178 LVQYVIENPMAVWFVGPLFAALTGLVFKEGL 208 >ref|XP_007142588.1| hypothetical protein PHAVU_007G000300g [Phaseolus vulgaris] gi|561015778|gb|ESW14582.1| hypothetical protein PHAVU_007G000300g [Phaseolus vulgaris] Length = 295 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 458 LIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 LI YV++NP+AIWFVGPLFAALTGLVFKEG+ Sbjct: 179 LIQYVVDNPSAIWFVGPLFAALTGLVFKEGL 209 >ref|XP_009802414.1| PREDICTED: uncharacterized protein LOC104247946 [Nicotiana sylvestris] Length = 291 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 461 TLIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 +L+ YVIEN TA+WFVGPLFAALTGLVFKEG+ Sbjct: 169 SLVQYVIENQTAVWFVGPLFAALTGLVFKEGL 200 >ref|XP_007043780.1| F3H9.20 protein [Theobroma cacao] gi|508707715|gb|EOX99611.1| F3H9.20 protein [Theobroma cacao] Length = 298 Score = 60.1 bits (144), Expect = 6e-07 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -2 Query: 458 LIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 L+ YV++NPTA+WFVGPLFA+LTGLVFKEG+ Sbjct: 178 LVQYVVDNPTAVWFVGPLFASLTGLVFKEGL 208 >ref|XP_003592175.1| integral membrane protein [Medicago truncatula] gi|355481223|gb|AES62426.1| integral membrane protein [Medicago truncatula] Length = 283 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 461 TLIDYVIENPTAIWFVGPLFAALTGLVFKEGI 366 TLI YVI+NP+A+W VGPLFAALTGLVFKEG+ Sbjct: 164 TLIQYVIDNPSAVWLVGPLFAALTGLVFKEGL 195