BLASTX nr result
ID: Gardenia21_contig00010389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00010389 (277 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP12099.1| unnamed protein product [Coffea canephora] 61 4e-07 >emb|CDP12099.1| unnamed protein product [Coffea canephora] Length = 519 Score = 60.8 bits (146), Expect = 4e-07 Identities = 32/70 (45%), Positives = 42/70 (60%), Gaps = 7/70 (10%) Frame = -3 Query: 257 REYQNEQIREWPASRHAKLKKVKIYGFRATRNEIEFLSYMVRSTPALELLKVRLSYRRY- 81 R + E+ REWP R +LK+V+ GF T NEI F +Y+V++ PALE L +R YR Y Sbjct: 409 RGFNEERGREWPPRRLGQLKEVEFNGFHGTVNEIHFATYLVKNAPALERLWIRSPYRFYC 468 Query: 80 ------TGGG 69 TGGG Sbjct: 469 DDYHLETGGG 478