BLASTX nr result
ID: Gardenia21_contig00010123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00010123 (312 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP15129.1| unnamed protein product [Coffea canephora] 93 2e-19 >emb|CDP15129.1| unnamed protein product [Coffea canephora] Length = 67 Score = 93.2 bits (230), Expect(2) = 2e-19 Identities = 46/52 (88%), Positives = 46/52 (88%) Frame = +1 Query: 115 QKFNTKPNLNLDDKLQTQKAKCSCDLPKQHSMRTQMPLLT*MLTRPSKIS*T 270 QKFNT NLNLDDKLQ QKAKCSCDLPKQHSMRTQMPLLT MLTRPSK S T Sbjct: 16 QKFNTTQNLNLDDKLQPQKAKCSCDLPKQHSMRTQMPLLTCMLTRPSKTSST 67 Score = 29.3 bits (64), Expect(2) = 2e-19 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +2 Query: 71 MFQDFQPRALDQL 109 MFQDFQPRAL+QL Sbjct: 1 MFQDFQPRALEQL 13