BLASTX nr result
ID: Gardenia21_contig00010026
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00010026 (1056 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13079.1| unnamed protein product [Coffea canephora] 64 1e-10 emb|CDP21603.1| unnamed protein product [Coffea canephora] 50 2e-08 emb|CDP17684.1| unnamed protein product [Coffea canephora] 62 6e-07 emb|CDP21336.1| unnamed protein product [Coffea canephora] 59 9e-06 >emb|CDP13079.1| unnamed protein product [Coffea canephora] Length = 110 Score = 64.3 bits (155), Expect(2) = 1e-10 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +2 Query: 2 MRRLTKFTHLGVRGCPLLRQRYTPYRGIYYLEEEISRDP 118 MRRLTK T + V CPLLRQ+YTP RGIYYLEEEIS DP Sbjct: 1 MRRLTKLTRVDVFDCPLLRQQYTPQRGIYYLEEEISSDP 39 Score = 30.4 bits (67), Expect(2) = 1e-10 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +3 Query: 171 DGAQTSASCCFPSLLMKK 224 D A+TSAS CFPSLL K+ Sbjct: 65 DSAETSASWCFPSLLKKR 82 >emb|CDP21603.1| unnamed protein product [Coffea canephora] Length = 212 Score = 50.4 bits (119), Expect(2) = 2e-08 Identities = 27/37 (72%), Positives = 28/37 (75%) Frame = +2 Query: 2 MRRLTKFTHLGVRGCPLLRQRYTPYRGIYYLEEEISR 112 MRRL K T + V CPLLRQRYT RGI YLEEEISR Sbjct: 127 MRRLVKLTSVEVSWCPLLRQRYTSQRGI-YLEEEISR 162 Score = 37.0 bits (84), Expect(2) = 2e-08 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 168 NDGAQTSASCCFPSLLMKK 224 NDG QTS SCCFPSLL K+ Sbjct: 169 NDGTQTSVSCCFPSLLKKE 187 >emb|CDP17684.1| unnamed protein product [Coffea canephora] Length = 1024 Score = 62.4 bits (150), Expect = 6e-07 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +2 Query: 2 MRRLTKFTHLGVRGCPLLRQRYTPYRGIYYLEEEISRDP 118 MRRLTK T + V CPLLRQRYT RGIYYLEEEIS DP Sbjct: 971 MRRLTKLTSVEVHFCPLLRQRYTSQRGIYYLEEEISSDP 1009 >emb|CDP21336.1| unnamed protein product [Coffea canephora] Length = 1105 Score = 58.5 bits (140), Expect = 9e-06 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +2 Query: 2 MRRLTKFTHLGVRGCPLLRQRYTPYRGIYYLEEEISRDP 118 MRRLTK T + V CPLLRQRYTP RGI YLEEEIS DP Sbjct: 1008 MRRLTKLTRVDVFDCPLLRQRYTPQRGI-YLEEEISSDP 1045