BLASTX nr result
ID: Gardenia21_contig00009461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00009461 (698 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH45938.1| hypothetical protein GLYMA_08G302100 [Glycine max] 61 8e-07 gb|KHN43225.1| hypothetical protein glysoja_001808, partial [Gly... 59 4e-06 >gb|KRH45938.1| hypothetical protein GLYMA_08G302100 [Glycine max] Length = 61 Score = 60.8 bits (146), Expect = 8e-07 Identities = 31/49 (63%), Positives = 34/49 (69%) Frame = -3 Query: 147 EYSCDICTHDKGYPGTVLLTWTGSMGDQEGPWPRLVTSIALGRGASLRS 1 E+ C + KG +LTW GSMGDQEGPWPR VTSIAL RGA LRS Sbjct: 9 EWCCSVKALAKGN----ILTWMGSMGDQEGPWPRAVTSIALRRGAVLRS 53 >gb|KHN43225.1| hypothetical protein glysoja_001808, partial [Glycine soja] Length = 44 Score = 58.5 bits (140), Expect = 4e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 96 LLTWTGSMGDQEGPWPRLVTSIALGRGASLRS 1 +LTW GSMGDQEG WPRLVTSIALG GA LRS Sbjct: 6 ILTWMGSMGDQEGLWPRLVTSIALGMGAHLRS 37