BLASTX nr result
ID: Gardenia21_contig00009379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00009379 (549 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP13090.1| unnamed protein product [Coffea canephora] 60 1e-08 emb|CDP13077.1| unnamed protein product [Coffea canephora] 60 1e-08 >emb|CDP13090.1| unnamed protein product [Coffea canephora] Length = 1126 Score = 60.5 bits (145), Expect(2) = 1e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 508 PDPNLKNATDRNEAQIPLELITQGVATLLMIQ 413 PDPNLKNATDRNEAQIP ELITQ VATLLMIQ Sbjct: 1041 PDPNLKNATDRNEAQIPSELITQCVATLLMIQ 1072 Score = 25.4 bits (54), Expect(2) = 1e-08 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 548 LPSDDSSIPTAAD 510 LPSDDSS+P A D Sbjct: 1030 LPSDDSSVPAAPD 1042 >emb|CDP13077.1| unnamed protein product [Coffea canephora] Length = 175 Score = 60.5 bits (145), Expect(2) = 1e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 508 PDPNLKNATDRNEAQIPLELITQGVATLLMIQ 413 PDPNLKNATDRNEAQIP ELITQ VATLLMIQ Sbjct: 68 PDPNLKNATDRNEAQIPSELITQCVATLLMIQ 99 Score = 25.4 bits (54), Expect(2) = 1e-08 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 548 LPSDDSSIPTAAD 510 LPSDDSS+P A D Sbjct: 57 LPSDDSSVPAAPD 69