BLASTX nr result
ID: Gardenia21_contig00009259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00009259 (320 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14376.1| unnamed protein product [Coffea canephora] 57 5e-06 ref|XP_009605939.1| PREDICTED: putative disease resistance prote... 57 7e-06 >emb|CDP14376.1| unnamed protein product [Coffea canephora] Length = 1153 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = -3 Query: 138 YVRLDTCPEIESFQQDVLPSSLHSLEISYCEKLMNHQRAWGLERLP 1 ++ L +CPE+E F + LPSSL SL+IS C+K+M+ +R WGLE+LP Sbjct: 993 HLNLFSCPELECFPKGGLPSSLQSLDISNCKKVMSCRREWGLEKLP 1038 >ref|XP_009605939.1| PREDICTED: putative disease resistance protein At3g14460 [Nicotiana tomentosiformis] Length = 1295 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = -3 Query: 129 LDTCPEIESFQQDVLPSSLHSLEISYCEKLMNHQRAWGLERLP 1 L+ CPEIESF + LPS+L L+IS C+KL+N ++ WGL+RLP Sbjct: 1094 LNKCPEIESFPEGGLPSNLQVLQISGCKKLVNGRKEWGLQRLP 1136