BLASTX nr result
ID: Gardenia21_contig00008867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00008867 (300 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP18241.1| unnamed protein product [Coffea canephora] 70 8e-10 ref|XP_011036944.1| PREDICTED: pyrophosphate-energized vacuolar ... 69 2e-09 ref|XP_010687850.1| PREDICTED: pyrophosphate-energized vacuolar ... 69 2e-09 gb|AIS71988.1| vacuolar pyrophosphatase 1 [Haloxylon ammodendron] 69 2e-09 ref|XP_009392139.1| PREDICTED: pyrophosphate-energized vacuolar ... 69 2e-09 ref|NP_001266772.1| uncharacterized LOC101027208 [Zea mays] gi|2... 69 2e-09 ref|XP_006382405.1| inorganic pyrophosphatase family protein [Po... 69 2e-09 ref|XP_006656699.1| PREDICTED: pyrophosphate-energized vacuolar ... 69 2e-09 gb|AAA61610.1| pyrophosphatase [Beta vulgaris] 69 2e-09 ref|XP_013710700.1| PREDICTED: pyrophosphate-energized vacuolar ... 68 3e-09 ref|XP_013699620.1| PREDICTED: pyrophosphate-energized vacuolar ... 68 3e-09 ref|XP_013682902.1| PREDICTED: pyrophosphate-energized vacuolar ... 68 3e-09 ref|XP_013604161.1| PREDICTED: pyrophosphate-energized vacuolar ... 68 3e-09 ref|XP_013585659.1| PREDICTED: pyrophosphate-energized vacuolar ... 68 3e-09 ref|XP_010476656.1| PREDICTED: pyrophosphate-energized vacuolar ... 68 3e-09 ref|XP_010459106.1| PREDICTED: pyrophosphate-energized vacuolar ... 68 3e-09 ref|XP_010497310.1| PREDICTED: pyrophosphate-energized vacuolar ... 68 3e-09 ref|XP_009418179.1| PREDICTED: pyrophosphate-energized vacuolar ... 68 3e-09 ref|XP_009117814.1| PREDICTED: pyrophosphate-energized vacuolar ... 68 3e-09 ref|XP_009148959.1| PREDICTED: pyrophosphate-energized vacuolar ... 68 3e-09 >emb|CDP18241.1| unnamed protein product [Coffea canephora] Length = 780 Score = 69.7 bits (169), Expect = 8e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL Sbjct: 747 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 780 >ref|XP_011036944.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Populus euphratica] Length = 764 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGGLLFKYL Sbjct: 731 SGPSLNILIKLMAVESLVFAPFFAAHGGLLFKYL 764 >ref|XP_010687850.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump [Beta vulgaris subsp. vulgaris] gi|870850665|gb|KMT02731.1| hypothetical protein BVRB_8g193170 [Beta vulgaris subsp. vulgaris] Length = 764 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGGLLFKYL Sbjct: 731 SGPSLNILIKLMAVESLVFAPFFATHGGLLFKYL 764 >gb|AIS71988.1| vacuolar pyrophosphatase 1 [Haloxylon ammodendron] Length = 767 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGGLLFKYL Sbjct: 734 SGPSLNILIKLMAVESLVFAPFFATHGGLLFKYL 767 >ref|XP_009392139.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Musa acuminata subsp. malaccensis] Length = 766 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGGLLFKYL Sbjct: 733 SGPSLNILIKLMAVESLVFAPFFATHGGLLFKYL 766 >ref|NP_001266772.1| uncharacterized LOC101027208 [Zea mays] gi|224028421|gb|ACN33286.1| unknown [Zea mays] gi|238011100|gb|ACR36585.1| unknown [Zea mays] Length = 762 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGGLLFKYL Sbjct: 729 SGPSLNILIKLMAVESLVFAPFFATHGGLLFKYL 762 >ref|XP_006382405.1| inorganic pyrophosphatase family protein [Populus trichocarpa] gi|550337765|gb|ERP60202.1| inorganic pyrophosphatase family protein [Populus trichocarpa] Length = 757 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGGLLFKYL Sbjct: 724 SGPSLNILIKLMAVESLVFAPFFAAHGGLLFKYL 757 >ref|XP_006656699.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Oryza brachyantha] Length = 801 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGGLLFKYL Sbjct: 768 SGPSLNILIKLMAVESLVFAPFFATHGGLLFKYL 801 >gb|AAA61610.1| pyrophosphatase [Beta vulgaris] Length = 765 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGGLLFKYL Sbjct: 732 SGPSLNILIKLMAVESLVFAPFFATHGGLLFKYL 765 >ref|XP_013710700.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Brassica napus] Length = 768 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGG+LFKYL Sbjct: 735 SGPSLNILIKLMAVESLVFAPFFATHGGILFKYL 768 >ref|XP_013699620.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Brassica napus] Length = 769 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGG+LFKYL Sbjct: 736 SGPSLNILIKLMAVESLVFAPFFATHGGILFKYL 769 >ref|XP_013682902.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Brassica napus] Length = 776 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGG+LFKYL Sbjct: 743 SGPSLNILIKLMAVESLVFAPFFATHGGILFKYL 776 >ref|XP_013604161.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Brassica oleracea var. oleracea] Length = 768 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGG+LFKYL Sbjct: 735 SGPSLNILIKLMAVESLVFAPFFATHGGILFKYL 768 >ref|XP_013585659.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1 [Brassica oleracea var. oleracea] Length = 771 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGG+LFKYL Sbjct: 738 SGPSLNILIKLMAVESLVFAPFFATHGGILFKYL 771 >ref|XP_010476656.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1 [Camelina sativa] Length = 766 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGG+LFKYL Sbjct: 733 SGPSLNILIKLMAVESLVFAPFFATHGGILFKYL 766 >ref|XP_010459106.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Camelina sativa] Length = 766 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGG+LFKYL Sbjct: 733 SGPSLNILIKLMAVESLVFAPFFATHGGILFKYL 766 >ref|XP_010497310.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Camelina sativa] Length = 766 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGG+LFKYL Sbjct: 733 SGPSLNILIKLMAVESLVFAPFFATHGGILFKYL 766 >ref|XP_009418179.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump [Musa acuminata subsp. malaccensis] Length = 766 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGG+LFKYL Sbjct: 733 SGPSLNILIKLMAVESLVFAPFFATHGGILFKYL 766 >ref|XP_009117814.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1 [Brassica rapa] Length = 768 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGG+LFKYL Sbjct: 735 SGPSLNILIKLMAVESLVFAPFFATHGGILFKYL 768 >ref|XP_009148959.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Brassica rapa] Length = 771 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 298 SGPSLNILIKLMAVESLVFAPFFASHGGLLFKYL 197 SGPSLNILIKLMAVESLVFAPFFA+HGG+LFKYL Sbjct: 738 SGPSLNILIKLMAVESLVFAPFFATHGGILFKYL 771