BLASTX nr result
ID: Gardenia21_contig00008746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00008746 (428 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98117.1| unnamed protein product [Coffea canephora] 72 2e-10 ref|XP_012849656.1| PREDICTED: monothiol glutaredoxin-S15, mitoc... 69 1e-09 ref|XP_002285351.1| PREDICTED: monothiol glutaredoxin-S15, mitoc... 69 2e-09 emb|CAN74745.1| hypothetical protein VITISV_033251 [Vitis vinifera] 69 2e-09 ref|XP_008228645.1| PREDICTED: monothiol glutaredoxin-S15, mitoc... 68 2e-09 ref|XP_007217383.1| hypothetical protein PRUPE_ppa024541mg, part... 68 2e-09 ref|XP_011087986.1| PREDICTED: monothiol glutaredoxin-S15, mitoc... 67 5e-09 ref|XP_008377616.1| PREDICTED: monothiol glutaredoxin-S15, mitoc... 66 9e-09 ref|XP_004302955.1| PREDICTED: monothiol glutaredoxin-S15, mitoc... 66 9e-09 ref|XP_014516688.1| PREDICTED: monothiol glutaredoxin-S15, mitoc... 66 1e-08 gb|KHN01349.1| Monothiol glutaredoxin-S15, mitochondrial [Glycin... 66 1e-08 gb|KHN47782.1| Monothiol glutaredoxin-S15, mitochondrial [Glycin... 65 2e-08 ref|XP_008237219.1| PREDICTED: monothiol glutaredoxin-S15, mitoc... 65 2e-08 ref|XP_008237217.1| PREDICTED: monothiol glutaredoxin-S15, mitoc... 65 2e-08 ref|XP_007201252.1| hypothetical protein PRUPE_ppa012405mg [Prun... 65 2e-08 gb|AFK35222.1| unknown [Lotus japonicus] 65 2e-08 ref|XP_010052543.1| PREDICTED: monothiol glutaredoxin-S15, mitoc... 65 2e-08 ref|XP_010052541.1| PREDICTED: monothiol glutaredoxin-S15, mitoc... 65 2e-08 gb|KCW76609.1| hypothetical protein EUGRSUZ_D00992 [Eucalyptus g... 65 2e-08 ref|XP_010052542.1| PREDICTED: monothiol glutaredoxin-S15, mitoc... 65 2e-08 >emb|CDO98117.1| unnamed protein product [Coffea canephora] Length = 170 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDRLEKVE 307 PQIFI+GEFIGGSDIILN+HQTGEL+EKLKD SD EKVE Sbjct: 131 PQIFIHGEFIGGSDIILNMHQTGELREKLKDTSDGQEKVE 170 >ref|XP_012849656.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial [Erythranthe guttatus] gi|604314146|gb|EYU27033.1| hypothetical protein MIMGU_mgv1a015194mg [Erythranthe guttata] Length = 165 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDRLE 316 PQIFINGEF+GGSDIILN+HQTGELKEKLK+IS++ E Sbjct: 129 PQIFINGEFVGGSDIILNMHQTGELKEKLKEISEKKE 165 >ref|XP_002285351.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial [Vitis vinifera] gi|297743395|emb|CBI36262.3| unnamed protein product [Vitis vinifera] Length = 170 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDRLEKVE 307 PQIFI GEFIGGSDIILN+HQTGELKEKLKD+S EK E Sbjct: 131 PQIFIKGEFIGGSDIILNMHQTGELKEKLKDVSAPQEKSE 170 >emb|CAN74745.1| hypothetical protein VITISV_033251 [Vitis vinifera] Length = 409 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDRLEKVE 307 PQIFI GEFIGGSDIILN+HQTGELKEKLKD+S EK E Sbjct: 370 PQIFIKGEFIGGSDIILNMHQTGELKEKLKDVSAPQEKSE 409 >ref|XP_008228645.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial [Prunus mume] Length = 171 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDRLEKVE 307 PQIFI GEFIGGSDIILN+HQTGELKEKL+DIS EK E Sbjct: 132 PQIFIKGEFIGGSDIILNMHQTGELKEKLQDISANQEKSE 171 >ref|XP_007217383.1| hypothetical protein PRUPE_ppa024541mg, partial [Prunus persica] gi|462413533|gb|EMJ18582.1| hypothetical protein PRUPE_ppa024541mg, partial [Prunus persica] Length = 146 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDRLEKVE 307 PQIFI GEFIGGSDIILN+HQTGELKEKL+DIS EK E Sbjct: 107 PQIFIKGEFIGGSDIILNMHQTGELKEKLQDISANQEKSE 146 >ref|XP_011087986.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial [Sesamum indicum] Length = 158 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/35 (82%), Positives = 35/35 (100%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDR 322 PQIFINGEF+GGSDIILN+HQTGELKEKLK+I+++ Sbjct: 122 PQIFINGEFVGGSDIILNMHQTGELKEKLKEIAEK 156 >ref|XP_008377616.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial [Malus domestica] Length = 172 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDRLEK 313 PQIFI GEF+GGSDIILN+HQ+GELKEKLKDIS EK Sbjct: 132 PQIFIKGEFVGGSDIILNMHQSGELKEKLKDISGGQEK 169 >ref|XP_004302955.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial [Fragaria vesca subsp. vesca] Length = 172 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDRLEKVE 307 PQIFI GEFIGGSDIILN+HQ GELKEKLKDI+ EK E Sbjct: 133 PQIFIKGEFIGGSDIILNMHQNGELKEKLKDIAASQEKSE 172 >ref|XP_014516688.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial [Vigna radiata var. radiata] Length = 161 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDR 322 PQIFI GEFIGGSDIILN+HQTGELKEKLKDI+ + Sbjct: 126 PQIFIKGEFIGGSDIILNMHQTGELKEKLKDITSK 160 >gb|KHN01349.1| Monothiol glutaredoxin-S15, mitochondrial [Glycine soja] Length = 161 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDR 322 PQIFI GEFIGGSDIILN+HQTGELKEKLKDI+ + Sbjct: 126 PQIFIKGEFIGGSDIILNMHQTGELKEKLKDITSK 160 >gb|KHN47782.1| Monothiol glutaredoxin-S15, mitochondrial [Glycine soja] gi|947095832|gb|KRH44417.1| hypothetical protein GLYMA_08G209900 [Glycine max] Length = 161 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDR 322 PQIFI GEFIGGSDI+LN+HQTGELKEKLKDI+ + Sbjct: 126 PQIFIKGEFIGGSDIVLNMHQTGELKEKLKDITSK 160 >ref|XP_008237219.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial-like isoform X2 [Prunus mume] Length = 137 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDRLEK 313 PQIFI GEFIGGSDIILN+HQ+GELKEKLKDI+ EK Sbjct: 98 PQIFIKGEFIGGSDIILNMHQSGELKEKLKDIAVNQEK 135 >ref|XP_008237217.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial-like isoform X1 [Prunus mume] gi|645263396|ref|XP_008237218.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial-like isoform X1 [Prunus mume] Length = 170 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDRLEK 313 PQIFI GEFIGGSDIILN+HQ+GELKEKLKDI+ EK Sbjct: 131 PQIFIKGEFIGGSDIILNMHQSGELKEKLKDIAVNQEK 168 >ref|XP_007201252.1| hypothetical protein PRUPE_ppa012405mg [Prunus persica] gi|595797259|ref|XP_007201253.1| hypothetical protein PRUPE_ppa012405mg [Prunus persica] gi|462396652|gb|EMJ02451.1| hypothetical protein PRUPE_ppa012405mg [Prunus persica] gi|462396653|gb|EMJ02452.1| hypothetical protein PRUPE_ppa012405mg [Prunus persica] Length = 170 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDRLEK 313 PQIFI GEFIGGSDIILN+HQ+GELKEKLKDI+ EK Sbjct: 131 PQIFIKGEFIGGSDIILNMHQSGELKEKLKDIAVNQEK 168 >gb|AFK35222.1| unknown [Lotus japonicus] Length = 163 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDR 322 PQIFI GEF+GGSDIILN+HQTGELKEKLKDI+ + Sbjct: 128 PQIFIKGEFVGGSDIILNMHQTGELKEKLKDITSK 162 >ref|XP_010052543.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial-like isoform X3 [Eucalyptus grandis] Length = 137 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDRLEK 313 PQIFI GEFIGGSDI++N+HQ+GELKEKLKDI+ EK Sbjct: 98 PQIFIKGEFIGGSDIVMNMHQSGELKEKLKDIATNQEK 135 >ref|XP_010052541.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial-like isoform X1 [Eucalyptus grandis] Length = 171 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDRLEK 313 PQIFI GEFIGGSDI++N+HQ+GELKEKLKDI+ EK Sbjct: 132 PQIFIKGEFIGGSDIVMNMHQSGELKEKLKDIATNQEK 169 >gb|KCW76609.1| hypothetical protein EUGRSUZ_D00992 [Eucalyptus grandis] Length = 94 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDRLEK 313 PQIFI GEFIGGSDI++N+HQ+GELKEKLKDI+ EK Sbjct: 55 PQIFIKGEFIGGSDIVMNMHQSGELKEKLKDIATNQEK 92 >ref|XP_010052542.1| PREDICTED: monothiol glutaredoxin-S15, mitochondrial-like isoform X2 [Eucalyptus grandis] gi|629111648|gb|KCW76608.1| hypothetical protein EUGRSUZ_D00992 [Eucalyptus grandis] Length = 170 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -3 Query: 426 PQIFINGEFIGGSDIILNLHQTGELKEKLKDISDRLEK 313 PQIFI GEFIGGSDI++N+HQ+GELKEKLKDI+ EK Sbjct: 131 PQIFIKGEFIGGSDIVMNMHQSGELKEKLKDIATNQEK 168