BLASTX nr result
ID: Gardenia21_contig00008535
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00008535 (310 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03608.1| unnamed protein product [Coffea canephora] 71 4e-10 ref|XP_007050660.1| F15K9.15 protein isoform 2 [Theobroma cacao]... 62 2e-07 ref|XP_007050659.1| F15K9.15 protein, putative isoform 1 [Theobr... 62 2e-07 ref|XP_010652141.1| PREDICTED: R3H domain-containing protein 4 i... 60 5e-07 ref|XP_010652143.1| PREDICTED: R3H domain-containing protein 4 i... 60 5e-07 emb|CBI32359.3| unnamed protein product [Vitis vinifera] 60 5e-07 emb|CAN83384.1| hypothetical protein VITISV_018232 [Vitis vinifera] 60 5e-07 ref|XP_010255888.1| PREDICTED: uncharacterized protein LOC104596... 57 4e-06 gb|KJB23109.1| hypothetical protein B456_004G082300 [Gossypium r... 56 9e-06 gb|KJB23108.1| hypothetical protein B456_004G082300 [Gossypium r... 56 9e-06 gb|KJB23107.1| hypothetical protein B456_004G082300 [Gossypium r... 56 9e-06 gb|KJB23106.1| hypothetical protein B456_004G082300 [Gossypium r... 56 9e-06 ref|XP_012473947.1| PREDICTED: uncharacterized protein LOC105790... 56 9e-06 gb|KHN03783.1| hypothetical protein glysoja_011012 [Glycine soja] 56 9e-06 ref|XP_006588625.1| PREDICTED: uncharacterized protein LOC100785... 56 9e-06 ref|XP_006418253.1| hypothetical protein EUTSA_v10008549mg [Eutr... 56 9e-06 ref|XP_006418252.1| hypothetical protein EUTSA_v10008549mg [Eutr... 56 9e-06 gb|ACU19387.1| unknown [Glycine max] 56 9e-06 >emb|CDP03608.1| unnamed protein product [Coffea canephora] Length = 249 Score = 70.9 bits (172), Expect = 4e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 102 ECIRDFVKEKGDGGVLELNVQDPFRRLLLHGVCE 1 ECIRDFVKE GDGGVLELNVQDPF RLLLHGVCE Sbjct: 166 ECIRDFVKETGDGGVLELNVQDPFHRLLLHGVCE 199 >ref|XP_007050660.1| F15K9.15 protein isoform 2 [Theobroma cacao] gi|590717663|ref|XP_007050661.1| F15K9.15 protein isoform 2 [Theobroma cacao] gi|508702921|gb|EOX94817.1| F15K9.15 protein isoform 2 [Theobroma cacao] gi|508702922|gb|EOX94818.1| F15K9.15 protein isoform 2 [Theobroma cacao] Length = 216 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 102 ECIRDFVKEKGDGGVLELNVQDPFRRLLLHGVCE 1 +CIR F+KE GDG VLEL VQDPF RLLLHGVCE Sbjct: 133 DCIRTFIKESGDGDVLELQVQDPFHRLLLHGVCE 166 >ref|XP_007050659.1| F15K9.15 protein, putative isoform 1 [Theobroma cacao] gi|508702920|gb|EOX94816.1| F15K9.15 protein, putative isoform 1 [Theobroma cacao] Length = 249 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 102 ECIRDFVKEKGDGGVLELNVQDPFRRLLLHGVCE 1 +CIR F+KE GDG VLEL VQDPF RLLLHGVCE Sbjct: 166 DCIRTFIKESGDGDVLELQVQDPFHRLLLHGVCE 199 >ref|XP_010652141.1| PREDICTED: R3H domain-containing protein 4 isoform X1 [Vitis vinifera] Length = 294 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 102 ECIRDFVKEKGDGGVLELNVQDPFRRLLLHGVCE 1 EC+R F+K+ GDG VL L+VQDPFRRLLLHGVCE Sbjct: 211 ECLRAFIKDSGDGDVLVLHVQDPFRRLLLHGVCE 244 >ref|XP_010652143.1| PREDICTED: R3H domain-containing protein 4 isoform X2 [Vitis vinifera] Length = 293 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 102 ECIRDFVKEKGDGGVLELNVQDPFRRLLLHGVCE 1 EC+R F+K+ GDG VL L+VQDPFRRLLLHGVCE Sbjct: 210 ECLRAFIKDSGDGDVLVLHVQDPFRRLLLHGVCE 243 >emb|CBI32359.3| unnamed protein product [Vitis vinifera] Length = 252 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 102 ECIRDFVKEKGDGGVLELNVQDPFRRLLLHGVCE 1 EC+R F+K+ GDG VL L+VQDPFRRLLLHGVCE Sbjct: 169 ECLRAFIKDSGDGDVLVLHVQDPFRRLLLHGVCE 202 >emb|CAN83384.1| hypothetical protein VITISV_018232 [Vitis vinifera] Length = 252 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 102 ECIRDFVKEKGDGGVLELNVQDPFRRLLLHGVCE 1 EC+R F+K+ GDG VL L+VQDPFRRLLLHGVCE Sbjct: 169 ECLRAFIKDSGDGDVLVLHVQDPFRRLLLHGVCE 202 >ref|XP_010255888.1| PREDICTED: uncharacterized protein LOC104596431 [Nelumbo nucifera] Length = 246 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 102 ECIRDFVKEKGDGGVLELNVQDPFRRLLLHGVCE 1 ECIR F+K+ GDG L L+VQDPF RLLLHGVCE Sbjct: 163 ECIRTFIKDSGDGDELVLHVQDPFHRLLLHGVCE 196 >gb|KJB23109.1| hypothetical protein B456_004G082300 [Gossypium raimondii] Length = 203 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 102 ECIRDFVKEKGDGGVLELNVQDPFRRLLLHGVCE 1 +CIR F++E+G G VL L VQDPF RLLLHGVCE Sbjct: 166 DCIRTFIQERGHGDVLALQVQDPFHRLLLHGVCE 199 >gb|KJB23108.1| hypothetical protein B456_004G082300 [Gossypium raimondii] Length = 208 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 102 ECIRDFVKEKGDGGVLELNVQDPFRRLLLHGVCE 1 +CIR F++E+G G VL L VQDPF RLLLHGVCE Sbjct: 166 DCIRTFIQERGHGDVLALQVQDPFHRLLLHGVCE 199 >gb|KJB23107.1| hypothetical protein B456_004G082300 [Gossypium raimondii] Length = 190 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 102 ECIRDFVKEKGDGGVLELNVQDPFRRLLLHGVCE 1 +CIR F++E+G G VL L VQDPF RLLLHGVCE Sbjct: 107 DCIRTFIQERGHGDVLALQVQDPFHRLLLHGVCE 140 >gb|KJB23106.1| hypothetical protein B456_004G082300 [Gossypium raimondii] Length = 186 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 102 ECIRDFVKEKGDGGVLELNVQDPFRRLLLHGVCE 1 +CIR F++E+G G VL L VQDPF RLLLHGVCE Sbjct: 103 DCIRTFIQERGHGDVLALQVQDPFHRLLLHGVCE 136 >ref|XP_012473947.1| PREDICTED: uncharacterized protein LOC105790746 [Gossypium raimondii] gi|763755774|gb|KJB23105.1| hypothetical protein B456_004G082300 [Gossypium raimondii] Length = 249 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 102 ECIRDFVKEKGDGGVLELNVQDPFRRLLLHGVCE 1 +CIR F++E+G G VL L VQDPF RLLLHGVCE Sbjct: 166 DCIRTFIQERGHGDVLALQVQDPFHRLLLHGVCE 199 >gb|KHN03783.1| hypothetical protein glysoja_011012 [Glycine soja] Length = 280 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -2 Query: 102 ECIRDFVKEKGDGGVLELNVQDPFRRLLLHGVCE 1 EC+R F+ E DG +LEL +QDPF RLLLHGVCE Sbjct: 197 ECVRAFITESTDGDILELQIQDPFHRLLLHGVCE 230 >ref|XP_006588625.1| PREDICTED: uncharacterized protein LOC100785058 [Glycine max] gi|947083279|gb|KRH32000.1| hypothetical protein GLYMA_10G025400 [Glycine max] Length = 244 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -2 Query: 102 ECIRDFVKEKGDGGVLELNVQDPFRRLLLHGVCE 1 EC+R F+ E DG +LEL +QDPF RLLLHGVCE Sbjct: 161 ECVRAFITESTDGDILELQIQDPFHRLLLHGVCE 194 >ref|XP_006418253.1| hypothetical protein EUTSA_v10008549mg [Eutrema salsugineum] gi|557096024|gb|ESQ36606.1| hypothetical protein EUTSA_v10008549mg [Eutrema salsugineum] Length = 254 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 102 ECIRDFVKEKGDGGVLELNVQDPFRRLLLHGVCE 1 +CI F+K+ G+G VLEL VQDPF RLLLHGVCE Sbjct: 170 QCISHFIKDGGEGDVLELKVQDPFHRLLLHGVCE 203 >ref|XP_006418252.1| hypothetical protein EUTSA_v10008549mg [Eutrema salsugineum] gi|557096023|gb|ESQ36605.1| hypothetical protein EUTSA_v10008549mg [Eutrema salsugineum] Length = 252 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 102 ECIRDFVKEKGDGGVLELNVQDPFRRLLLHGVCE 1 +CI F+K+ G+G VLEL VQDPF RLLLHGVCE Sbjct: 168 QCISHFIKDGGEGDVLELKVQDPFHRLLLHGVCE 201 >gb|ACU19387.1| unknown [Glycine max] Length = 244 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -2 Query: 102 ECIRDFVKEKGDGGVLELNVQDPFRRLLLHGVCE 1 EC+R F+ E DG +LEL +QDPF RLLLHGVCE Sbjct: 161 ECVRAFITESTDGDILELQIQDPFHRLLLHGVCE 194