BLASTX nr result
ID: Gardenia21_contig00007784
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00007784 (2190 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322815.1| hypothetical protein POPTR_0016s07700g [Popu... 70 1e-08 >ref|XP_002322815.1| hypothetical protein POPTR_0016s07700g [Populus trichocarpa] gi|222867445|gb|EEF04576.1| hypothetical protein POPTR_0016s07700g [Populus trichocarpa] Length = 63 Score = 69.7 bits (169), Expect = 1e-08 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 12/50 (24%) Frame = -3 Query: 1993 MMTNPKACFS------------NIRSGRLRAFAFAGLESLCCLLLPWMSE 1880 MM NPKACFS NIRSGRLRAFAFAGLESLCC +LPWMSE Sbjct: 1 MMINPKACFSKHSQWPSKLVSQNIRSGRLRAFAFAGLESLCCFILPWMSE 50