BLASTX nr result
ID: Gardenia21_contig00007689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00007689 (209 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP11365.1| unnamed protein product [Coffea canephora] 93 9e-17 emb|CDP11360.1| unnamed protein product [Coffea canephora] 92 2e-16 emb|CDP11364.1| unnamed protein product [Coffea canephora] 90 8e-16 emb|CDP11362.1| unnamed protein product [Coffea canephora] 90 8e-16 emb|CDP11363.1| unnamed protein product [Coffea canephora] 86 8e-15 emb|CDP21825.1| unnamed protein product [Coffea canephora] 86 8e-15 emb|CDP16211.1| unnamed protein product [Coffea canephora] 84 5e-14 emb|CDP20777.1| unnamed protein product, partial [Coffea canephora] 83 7e-14 emb|CDP16212.1| unnamed protein product [Coffea canephora] 80 5e-13 emb|CDP19430.1| unnamed protein product [Coffea canephora] 79 1e-12 emb|CDP11357.1| unnamed protein product [Coffea canephora] 79 2e-12 >emb|CDP11365.1| unnamed protein product [Coffea canephora] Length = 644 Score = 92.8 bits (229), Expect = 9e-17 Identities = 46/57 (80%), Positives = 51/57 (89%) Frame = -1 Query: 206 MLNSGSVTLPTPHRPAVLRSYGSESRVEELKVDQSNARRISAPCSVSEASITELYPR 36 MLN GSV+LPTPHRPAV RS GSESRV+ELKVDQSN +RISAP SV++ASITE YPR Sbjct: 588 MLNPGSVSLPTPHRPAVFRSNGSESRVDELKVDQSNTQRISAPSSVNDASITEPYPR 644 >emb|CDP11360.1| unnamed protein product [Coffea canephora] Length = 63 Score = 92.0 bits (227), Expect = 2e-16 Identities = 46/57 (80%), Positives = 51/57 (89%) Frame = -1 Query: 206 MLNSGSVTLPTPHRPAVLRSYGSESRVEELKVDQSNARRISAPCSVSEASITELYPR 36 MLN GSV+LPTPHRPAV RS G ESRV+ELKVDQSNA+RISAP SV++ASITE YPR Sbjct: 7 MLNPGSVSLPTPHRPAVFRSNGLESRVDELKVDQSNAQRISAPSSVNDASITEPYPR 63 >emb|CDP11364.1| unnamed protein product [Coffea canephora] Length = 415 Score = 89.7 bits (221), Expect = 8e-16 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -1 Query: 209 HMLNSGSVTLPTPHRPAVLRSYGSESRVEELKVDQSNARRISAPCSVSEASITELYPR 36 +MLNS SVTLPTPHRPAV RS+GSES VEEL+V+QSN RIS P SV+EASITE YPR Sbjct: 358 NMLNSSSVTLPTPHRPAVFRSHGSESIVEELEVEQSNTERISIPSSVNEASITEPYPR 415 >emb|CDP11362.1| unnamed protein product [Coffea canephora] Length = 654 Score = 89.7 bits (221), Expect = 8e-16 Identities = 44/57 (77%), Positives = 49/57 (85%) Frame = -1 Query: 206 MLNSGSVTLPTPHRPAVLRSYGSESRVEELKVDQSNARRISAPCSVSEASITELYPR 36 MLN SV LPTPHRPA RS+GSESRV+ELKVDQSN +RISAP SV++ASITE YPR Sbjct: 598 MLNPSSVPLPTPHRPAAFRSHGSESRVDELKVDQSNTQRISAPSSVNDASITEPYPR 654 >emb|CDP11363.1| unnamed protein product [Coffea canephora] Length = 687 Score = 86.3 bits (212), Expect = 8e-15 Identities = 44/58 (75%), Positives = 49/58 (84%) Frame = -1 Query: 209 HMLNSGSVTLPTPHRPAVLRSYGSESRVEELKVDQSNARRISAPCSVSEASITELYPR 36 +MLNS SVTLPTPHRPAV RS+GSES VEEL+V+QSN RIS P SV+EASITE PR Sbjct: 630 NMLNSSSVTLPTPHRPAVFRSHGSESIVEELEVEQSNTERISIPSSVNEASITEPCPR 687 >emb|CDP21825.1| unnamed protein product [Coffea canephora] Length = 412 Score = 86.3 bits (212), Expect = 8e-15 Identities = 42/58 (72%), Positives = 49/58 (84%) Frame = -1 Query: 209 HMLNSGSVTLPTPHRPAVLRSYGSESRVEELKVDQSNARRISAPCSVSEASITELYPR 36 +MLN SVTLPTPHRPAV RS+GSES VEE++V+QSN RIS P SV+EA+ITE YPR Sbjct: 355 NMLNCSSVTLPTPHRPAVFRSHGSESMVEEVEVEQSNTERISIPSSVNEATITEPYPR 412 >emb|CDP16211.1| unnamed protein product [Coffea canephora] Length = 680 Score = 83.6 bits (205), Expect = 5e-14 Identities = 43/57 (75%), Positives = 47/57 (82%) Frame = -1 Query: 206 MLNSGSVTLPTPHRPAVLRSYGSESRVEELKVDQSNARRISAPCSVSEASITELYPR 36 MLN SV L TPH PAV RS GSESRV++LKVDQSN +RISAP SV+EASITE YPR Sbjct: 624 MLNPSSVPLRTPHCPAVFRSCGSESRVDDLKVDQSNTQRISAPSSVNEASITEQYPR 680 >emb|CDP20777.1| unnamed protein product, partial [Coffea canephora] Length = 399 Score = 83.2 bits (204), Expect = 7e-14 Identities = 41/58 (70%), Positives = 48/58 (82%) Frame = -1 Query: 209 HMLNSGSVTLPTPHRPAVLRSYGSESRVEELKVDQSNARRISAPCSVSEASITELYPR 36 +MLN SVTLPTPHRPAV S+GSES VEE++V+QSN RIS P SV+EA+ITE YPR Sbjct: 342 NMLNCSSVTLPTPHRPAVFWSHGSESMVEEVEVEQSNTERISIPSSVNEATITEPYPR 399 >emb|CDP16212.1| unnamed protein product [Coffea canephora] Length = 416 Score = 80.5 bits (197), Expect = 5e-13 Identities = 41/57 (71%), Positives = 46/57 (80%) Frame = -1 Query: 206 MLNSGSVTLPTPHRPAVLRSYGSESRVEELKVDQSNARRISAPCSVSEASITELYPR 36 MLN+ SVTLPTPH PAV R +GSE RV EL+V+QSN RISAP SV+EASITE PR Sbjct: 360 MLNNSSVTLPTPHCPAVFRRHGSEGRVGELEVEQSNTERISAPSSVNEASITEPCPR 416 >emb|CDP19430.1| unnamed protein product [Coffea canephora] Length = 415 Score = 79.0 bits (193), Expect = 1e-12 Identities = 39/58 (67%), Positives = 47/58 (81%) Frame = -1 Query: 209 HMLNSGSVTLPTPHRPAVLRSYGSESRVEELKVDQSNARRISAPCSVSEASITELYPR 36 +MLNS SVTLPTP RPAV R + +ES VEE++V+QSN RIS P SV+EA+ITE YPR Sbjct: 354 NMLNSSSVTLPTPRRPAVFRCHETESMVEEVEVEQSNTERISIPSSVNEATITEPYPR 411 >emb|CDP11357.1| unnamed protein product [Coffea canephora] Length = 190 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/58 (67%), Positives = 47/58 (81%) Frame = -1 Query: 209 HMLNSGSVTLPTPHRPAVLRSYGSESRVEELKVDQSNARRISAPCSVSEASITELYPR 36 +MLNS SVTLPTP RPAV R + +ES VEE++V+QSN RIS P SV+EA+ITE YPR Sbjct: 133 NMLNSSSVTLPTPRRPAVFRFHETESMVEEVEVEQSNTERISIPSSVNEATITEPYPR 190