BLASTX nr result
ID: Gardenia21_contig00007536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00007536 (272 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007031579.1| RNA-binding (RRM/RBD/RNP motifs) family prot... 56 9e-06 >ref|XP_007031579.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma cacao] gi|590646283|ref|XP_007031580.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma cacao] gi|508710608|gb|EOY02505.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma cacao] gi|508710609|gb|EOY02506.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma cacao] Length = 344 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/67 (34%), Positives = 42/67 (62%), Gaps = 2/67 (2%) Frame = +2 Query: 11 IRGHSAAWLLGYGRNIGYTTNSVA--WAIKDGLQLAIQRNYTRILVAADLKVIIELLNNQ 184 IR W +GY R +G T++ A W ++DGLQLA++R +++ DL+V+++L+ + Sbjct: 92 IRNDQGEWNVGYSRKLGQATSTCAEHWGLRDGLQLAVKRGLFDVIIKVDLQVVLDLICKE 151 Query: 185 STNQHVL 205 + + H L Sbjct: 152 AVDSHTL 158