BLASTX nr result
ID: Gardenia21_contig00007409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00007409 (221 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP09238.1| unnamed protein product [Coffea canephora] 74 4e-11 gb|AKG06588.1| cinnamoyl-CoA reductase 9 [Populus tomentosa] 65 1e-08 ref|XP_011003545.1| PREDICTED: cinnamoyl-CoA reductase 1 isoform... 65 1e-08 ref|XP_011003535.1| PREDICTED: cinnamoyl-CoA reductase 1 isoform... 65 1e-08 ref|XP_002313227.1| putative cinnamoyl-CoA reductase family prot... 65 1e-08 ref|XP_009794045.1| PREDICTED: cinnamoyl-CoA reductase 1 [Nicoti... 65 3e-08 ref|XP_009615422.1| PREDICTED: cinnamoyl-CoA reductase 1 [Nicoti... 65 3e-08 ref|XP_012079008.1| PREDICTED: cinnamoyl-CoA reductase 1 [Jatrop... 65 3e-08 gb|AHZ08759.1| dihydroflavonol reductase [Nicotiana tabacum] 65 3e-08 gb|AIX92154.1| cinnamoyl-CoA reductase 1 [Betula platyphylla] 64 6e-08 gb|AIX92153.1| cinnamoyl-CoA reductase 1 [Betula platyphylla] 64 6e-08 ref|XP_007205561.1| hypothetical protein PRUPE_ppa008662mg [Prun... 64 6e-08 gb|AFN26940.1| cinnamoyl-CoA reductase [Betula platyphylla] 64 6e-08 ref|XP_010043393.1| PREDICTED: cinnamoyl-CoA reductase 1 [Eucaly... 63 7e-08 gb|KCW85396.1| hypothetical protein EUGRSUZ_B02222 [Eucalyptus g... 63 7e-08 gb|KCW85395.1| hypothetical protein EUGRSUZ_B02222 [Eucalyptus g... 63 7e-08 ref|XP_006425131.1| hypothetical protein CICLE_v10028839mg [Citr... 63 7e-08 gb|EMS56593.1| Dihydroflavonol-4-reductase [Triticum urartu] 63 1e-07 ref|XP_002275195.1| PREDICTED: cinnamoyl-CoA reductase 1 [Vitis ... 63 1e-07 ref|XP_010266624.1| PREDICTED: dihydroflavonol-4-reductase-like ... 62 1e-07 >emb|CDP09238.1| unnamed protein product [Coffea canephora] Length = 323 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +3 Query: 117 MAKREEVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 MAKREEVVCVTGGSGYIGSWLVRLLL+RGYTVHAT Sbjct: 1 MAKREEVVCVTGGSGYIGSWLVRLLLDRGYTVHAT 35 >gb|AKG06588.1| cinnamoyl-CoA reductase 9 [Populus tomentosa] Length = 323 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 117 MAKREEVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 M+K+ EVVCVTGGSG IGSWLVRLLL+RGYTVHAT Sbjct: 1 MSKKGEVVCVTGGSGCIGSWLVRLLLDRGYTVHAT 35 >ref|XP_011003545.1| PREDICTED: cinnamoyl-CoA reductase 1 isoform X2 [Populus euphratica] Length = 298 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 117 MAKREEVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 M+K+ EVVCVTGGSG IGSWLVRLLL+RGYTVHAT Sbjct: 1 MSKKGEVVCVTGGSGCIGSWLVRLLLDRGYTVHAT 35 >ref|XP_011003535.1| PREDICTED: cinnamoyl-CoA reductase 1 isoform X1 [Populus euphratica] Length = 323 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 117 MAKREEVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 M+K+ EVVCVTGGSG IGSWLVRLLL+RGYTVHAT Sbjct: 1 MSKKGEVVCVTGGSGCIGSWLVRLLLDRGYTVHAT 35 >ref|XP_002313227.1| putative cinnamoyl-CoA reductase family protein [Populus trichocarpa] gi|222849635|gb|EEE87182.1| putative cinnamoyl-CoA reductase family protein [Populus trichocarpa] Length = 323 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 117 MAKREEVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 M+K+ EVVCVTGGSG IGSWLVRLLL+RGYTVHAT Sbjct: 1 MSKKGEVVCVTGGSGCIGSWLVRLLLDRGYTVHAT 35 >ref|XP_009794045.1| PREDICTED: cinnamoyl-CoA reductase 1 [Nicotiana sylvestris] Length = 324 Score = 64.7 bits (156), Expect = 3e-08 Identities = 32/36 (88%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +3 Query: 117 MAKRE-EVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 MA R EVVCVTGGSGYIGSWLVR LLERGYTVHAT Sbjct: 1 MANRAGEVVCVTGGSGYIGSWLVRFLLERGYTVHAT 36 >ref|XP_009615422.1| PREDICTED: cinnamoyl-CoA reductase 1 [Nicotiana tomentosiformis] Length = 324 Score = 64.7 bits (156), Expect = 3e-08 Identities = 32/36 (88%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +3 Query: 117 MAKRE-EVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 MA R EVVCVTGGSGYIGSWLVR LLERGYTVHAT Sbjct: 1 MANRAGEVVCVTGGSGYIGSWLVRFLLERGYTVHAT 36 >ref|XP_012079008.1| PREDICTED: cinnamoyl-CoA reductase 1 [Jatropha curcas] gi|643740095|gb|KDP45781.1| hypothetical protein JCGZ_17388 [Jatropha curcas] Length = 323 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +3 Query: 117 MAKREEVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 M+K +VVCVTGGSG IGSWLVRLLLERGYTVHAT Sbjct: 1 MSKEGQVVCVTGGSGCIGSWLVRLLLERGYTVHAT 35 >gb|AHZ08759.1| dihydroflavonol reductase [Nicotiana tabacum] Length = 324 Score = 64.7 bits (156), Expect = 3e-08 Identities = 32/36 (88%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = +3 Query: 117 MAKRE-EVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 MA R EVVCVTGGSGYIGSWLVR LLERGYTVHAT Sbjct: 1 MANRAGEVVCVTGGSGYIGSWLVRFLLERGYTVHAT 36 >gb|AIX92154.1| cinnamoyl-CoA reductase 1 [Betula platyphylla] Length = 323 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +3 Query: 117 MAKREEVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 MAK EVVCVTGGSG IGSWLVRLLL+RGY VHAT Sbjct: 1 MAKEGEVVCVTGGSGCIGSWLVRLLLDRGYIVHAT 35 >gb|AIX92153.1| cinnamoyl-CoA reductase 1 [Betula platyphylla] Length = 352 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +3 Query: 117 MAKREEVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 MA EVVCVTGGSG IGSWLVRLLL+RGYTVHAT Sbjct: 33 MATEGEVVCVTGGSGCIGSWLVRLLLDRGYTVHAT 67 >ref|XP_007205561.1| hypothetical protein PRUPE_ppa008662mg [Prunus persica] gi|462401203|gb|EMJ06760.1| hypothetical protein PRUPE_ppa008662mg [Prunus persica] Length = 323 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 117 MAKREEVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 M+K +EVVCVTGGSG IGSWLVRLLL+R YTVHAT Sbjct: 1 MSKTDEVVCVTGGSGCIGSWLVRLLLDRNYTVHAT 35 >gb|AFN26940.1| cinnamoyl-CoA reductase [Betula platyphylla] Length = 323 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +3 Query: 117 MAKREEVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 MA EVVCVTGGSG IGSWLVRLLL+RGYTVHAT Sbjct: 1 MATEGEVVCVTGGSGCIGSWLVRLLLDRGYTVHAT 35 >ref|XP_010043393.1| PREDICTED: cinnamoyl-CoA reductase 1 [Eucalyptus grandis] Length = 323 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 117 MAKREEVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 M+K+ E CVTGGSG IGSWLVRLLLERGYTVHAT Sbjct: 1 MSKQGEAACVTGGSGCIGSWLVRLLLERGYTVHAT 35 >gb|KCW85396.1| hypothetical protein EUGRSUZ_B02222 [Eucalyptus grandis] Length = 361 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 117 MAKREEVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 M+K+ E CVTGGSG IGSWLVRLLLERGYTVHAT Sbjct: 40 MSKQGEAACVTGGSGCIGSWLVRLLLERGYTVHAT 74 >gb|KCW85395.1| hypothetical protein EUGRSUZ_B02222 [Eucalyptus grandis] Length = 362 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 117 MAKREEVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 M+K+ E CVTGGSG IGSWLVRLLLERGYTVHAT Sbjct: 40 MSKQGEAACVTGGSGCIGSWLVRLLLERGYTVHAT 74 >ref|XP_006425131.1| hypothetical protein CICLE_v10028839mg [Citrus clementina] gi|557527065|gb|ESR38371.1| hypothetical protein CICLE_v10028839mg [Citrus clementina] Length = 323 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +3 Query: 117 MAKREEVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 M+K EVVCVTGGSG IGSWLVRLLLER YTVHAT Sbjct: 1 MSKEAEVVCVTGGSGCIGSWLVRLLLERRYTVHAT 35 >gb|EMS56593.1| Dihydroflavonol-4-reductase [Triticum urartu] Length = 387 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 126 REEVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 R E+VCVTGGSG++GSWLVRLLL+RGYTVHAT Sbjct: 9 RGELVCVTGGSGFVGSWLVRLLLDRGYTVHAT 40 >ref|XP_002275195.1| PREDICTED: cinnamoyl-CoA reductase 1 [Vitis vinifera] gi|297745846|emb|CBI15902.3| unnamed protein product [Vitis vinifera] Length = 329 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 126 REEVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 R EVVCVTGGSGYIGSWLV LLL RGYTVHAT Sbjct: 10 RSEVVCVTGGSGYIGSWLVCLLLRRGYTVHAT 41 >ref|XP_010266624.1| PREDICTED: dihydroflavonol-4-reductase-like [Nelumbo nucifera] Length = 380 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 108 WKKMAKREEVVCVTGGSGYIGSWLVRLLLERGYTVHAT 221 WKK ++VVCVTGG+GYIGS LV+ LLE+GYTVHAT Sbjct: 38 WKKKGNNDDVVCVTGGAGYIGSCLVKKLLEKGYTVHAT 75