BLASTX nr result
ID: Gardenia21_contig00007386
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00007386 (602 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP11398.1| unnamed protein product [Coffea canephora] 86 2e-14 >emb|CDP11398.1| unnamed protein product [Coffea canephora] Length = 366 Score = 85.5 bits (210), Expect = 2e-14 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -2 Query: 565 YSFLWGKNKESKIHAIEEKSNQTKEEVGLECITCTSTCNEVGEEKK 428 YSFLWGKNKE++IH EEKSNQTKEEV LECITCT TCNE GEEK+ Sbjct: 321 YSFLWGKNKETEIHGSEEKSNQTKEEVALECITCTPTCNEDGEEKR 366