BLASTX nr result
ID: Gardenia21_contig00007332
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00007332 (753 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007023691.1| Ergosterol biosynthesis ERG4/ERG24 family is... 63 2e-07 ref|XP_007023690.1| Ergosterol biosynthesis ERG4/ERG24 family is... 63 2e-07 ref|XP_012456375.1| PREDICTED: 7-dehydrocholesterol reductase [G... 62 3e-07 gb|KJB68762.1| hypothetical protein B456_011G002700 [Gossypium r... 62 3e-07 emb|CDO97737.1| unnamed protein product [Coffea canephora] 62 3e-07 gb|ABA01480.1| sterol delta-7 reductase DWF5 [Gossypium hirsutum] 62 3e-07 ref|XP_014515001.1| PREDICTED: 7-dehydrocholesterol reductase [V... 62 4e-07 gb|KOM27216.1| hypothetical protein LR48_Vigan406s002600 [Vigna ... 62 4e-07 ref|XP_012573268.1| PREDICTED: 7-dehydrocholesterol reductase [C... 62 4e-07 gb|KJB68763.1| hypothetical protein B456_011G002700 [Gossypium r... 62 4e-07 ref|XP_011046540.1| PREDICTED: 7-dehydrocholesterol reductase [P... 62 4e-07 gb|KHN38096.1| 7-dehydrocholesterol reductase [Glycine soja] 62 4e-07 ref|XP_013622239.1| PREDICTED: 7-dehydrocholesterol reductase [B... 62 4e-07 ref|XP_009107218.1| PREDICTED: 7-dehydrocholesterol reductase [B... 62 4e-07 ref|XP_008462206.1| PREDICTED: 7-dehydrocholesterol reductase [C... 62 4e-07 ref|XP_002316435.1| putative delta-7-sterol reductase family pro... 62 4e-07 ref|XP_006584149.1| PREDICTED: 7-dehydrocholesterol reductase-li... 62 4e-07 ref|XP_006465140.1| PREDICTED: 7-dehydrocholesterol reductase-li... 62 4e-07 ref|XP_007135855.1| hypothetical protein PHAVU_010G163700g [Phas... 62 4e-07 ref|XP_006436353.1| hypothetical protein CICLE_v100316311mg, par... 62 4e-07 >ref|XP_007023691.1| Ergosterol biosynthesis ERG4/ERG24 family isoform 2 [Theobroma cacao] gi|508779057|gb|EOY26313.1| Ergosterol biosynthesis ERG4/ERG24 family isoform 2 [Theobroma cacao] Length = 438 Score = 62.8 bits (151), Expect = 2e-07 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AKMKSL 105 FLPYFYVVFLTILLFDRAKRDDDRCRSK K L Sbjct: 390 FLPYFYVVFLTILLFDRAKRDDDRCRSKYGKFWKL 424 >ref|XP_007023690.1| Ergosterol biosynthesis ERG4/ERG24 family isoform 1 [Theobroma cacao] gi|508779056|gb|EOY26312.1| Ergosterol biosynthesis ERG4/ERG24 family isoform 1 [Theobroma cacao] Length = 437 Score = 62.8 bits (151), Expect = 2e-07 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AKMKSL 105 FLPYFYVVFLTILLFDRAKRDDDRCRSK K L Sbjct: 389 FLPYFYVVFLTILLFDRAKRDDDRCRSKYGKFWKL 423 >ref|XP_012456375.1| PREDICTED: 7-dehydrocholesterol reductase [Gossypium raimondii] Length = 437 Score = 62.4 bits (150), Expect = 3e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AK 93 FLPYFYVVFLTILLFDRAKRDDDRCRSK K Sbjct: 389 FLPYFYVVFLTILLFDRAKRDDDRCRSKYGK 419 >gb|KJB68762.1| hypothetical protein B456_011G002700 [Gossypium raimondii] Length = 477 Score = 62.4 bits (150), Expect = 3e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AK 93 FLPYFYVVFLTILLFDRAKRDDDRCRSK K Sbjct: 429 FLPYFYVVFLTILLFDRAKRDDDRCRSKYGK 459 >emb|CDO97737.1| unnamed protein product [Coffea canephora] Length = 433 Score = 62.4 bits (150), Expect = 3e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AK 93 FLPYFYVVFLTILLFDRAKRDDDRCRSK K Sbjct: 385 FLPYFYVVFLTILLFDRAKRDDDRCRSKYGK 415 >gb|ABA01480.1| sterol delta-7 reductase DWF5 [Gossypium hirsutum] Length = 437 Score = 62.4 bits (150), Expect = 3e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AK 93 FLPYFYVVFLTILLFDRAKRDDDRCRSK K Sbjct: 389 FLPYFYVVFLTILLFDRAKRDDDRCRSKYGK 419 >ref|XP_014515001.1| PREDICTED: 7-dehydrocholesterol reductase [Vigna radiata var. radiata] Length = 444 Score = 62.0 bits (149), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AK 93 FLPYFYV+FLTILLFDRAKRDDDRCRSK K Sbjct: 396 FLPYFYVIFLTILLFDRAKRDDDRCRSKYGK 426 >gb|KOM27216.1| hypothetical protein LR48_Vigan406s002600 [Vigna angularis] Length = 391 Score = 62.0 bits (149), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AK 93 FLPYFYV+FLTILLFDRAKRDDDRCRSK K Sbjct: 343 FLPYFYVIFLTILLFDRAKRDDDRCRSKYGK 373 >ref|XP_012573268.1| PREDICTED: 7-dehydrocholesterol reductase [Cicer arietinum] Length = 436 Score = 62.0 bits (149), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AK 93 FLPYFYV+FLTILLFDRAKRDDDRCRSK K Sbjct: 388 FLPYFYVIFLTILLFDRAKRDDDRCRSKYGK 418 >gb|KJB68763.1| hypothetical protein B456_011G002700 [Gossypium raimondii] Length = 416 Score = 62.0 bits (149), Expect = 4e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK 84 FLPYFYVVFLTILLFDRAKRDDDRCRSK Sbjct: 389 FLPYFYVVFLTILLFDRAKRDDDRCRSK 416 >ref|XP_011046540.1| PREDICTED: 7-dehydrocholesterol reductase [Populus euphratica] Length = 434 Score = 62.0 bits (149), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AK 93 FLPYFYV+FLTILLFDRAKRDDDRCRSK K Sbjct: 386 FLPYFYVIFLTILLFDRAKRDDDRCRSKYGK 416 >gb|KHN38096.1| 7-dehydrocholesterol reductase [Glycine soja] Length = 558 Score = 62.0 bits (149), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AK 93 FLPYFYV+FLTILLFDRAKRDDDRCRSK K Sbjct: 384 FLPYFYVIFLTILLFDRAKRDDDRCRSKYGK 414 >ref|XP_013622239.1| PREDICTED: 7-dehydrocholesterol reductase [Brassica oleracea var. oleracea] gi|923886754|ref|XP_013714731.1| PREDICTED: 7-dehydrocholesterol reductase [Brassica napus] gi|674929790|emb|CDY03603.1| BnaC03g68620D [Brassica napus] Length = 432 Score = 62.0 bits (149), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AK 93 FLPYFYV+FLTILLFDRAKRDDDRCRSK K Sbjct: 384 FLPYFYVIFLTILLFDRAKRDDDRCRSKYGK 414 >ref|XP_009107218.1| PREDICTED: 7-dehydrocholesterol reductase [Brassica rapa] gi|923548591|ref|XP_013735823.1| PREDICTED: 7-dehydrocholesterol reductase-like [Brassica napus] gi|674887594|emb|CDY45061.1| BnaA08g02140D [Brassica napus] Length = 432 Score = 62.0 bits (149), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AK 93 FLPYFYV+FLTILLFDRAKRDDDRCRSK K Sbjct: 384 FLPYFYVIFLTILLFDRAKRDDDRCRSKYGK 414 >ref|XP_008462206.1| PREDICTED: 7-dehydrocholesterol reductase [Cucumis melo] Length = 435 Score = 62.0 bits (149), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AK 93 FLPYFYV+FLTILLFDRAKRDDDRCRSK K Sbjct: 387 FLPYFYVIFLTILLFDRAKRDDDRCRSKYGK 417 >ref|XP_002316435.1| putative delta-7-sterol reductase family protein [Populus trichocarpa] gi|222865475|gb|EEF02606.1| putative delta-7-sterol reductase family protein [Populus trichocarpa] Length = 434 Score = 62.0 bits (149), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AK 93 FLPYFYV+FLTILLFDRAKRDDDRCRSK K Sbjct: 386 FLPYFYVIFLTILLFDRAKRDDDRCRSKYGK 416 >ref|XP_006584149.1| PREDICTED: 7-dehydrocholesterol reductase-like [Glycine max] Length = 120 Score = 62.0 bits (149), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AK 93 FLPYFYV+FLTILLFDRAKRDDDRCRSK K Sbjct: 72 FLPYFYVIFLTILLFDRAKRDDDRCRSKHGK 102 >ref|XP_006465140.1| PREDICTED: 7-dehydrocholesterol reductase-like [Citrus sinensis] Length = 437 Score = 62.0 bits (149), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AK 93 FLPYFYV+FLTILLFDRAKRDDDRCRSK K Sbjct: 389 FLPYFYVIFLTILLFDRAKRDDDRCRSKYGK 419 >ref|XP_007135855.1| hypothetical protein PHAVU_010G163700g [Phaseolus vulgaris] gi|561008900|gb|ESW07849.1| hypothetical protein PHAVU_010G163700g [Phaseolus vulgaris] Length = 444 Score = 62.0 bits (149), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AK 93 FLPYFYV+FLTILLFDRAKRDDDRCRSK K Sbjct: 396 FLPYFYVIFLTILLFDRAKRDDDRCRSKYGK 426 >ref|XP_006436353.1| hypothetical protein CICLE_v100316311mg, partial [Citrus clementina] gi|557538549|gb|ESR49593.1| hypothetical protein CICLE_v100316311mg, partial [Citrus clementina] Length = 76 Score = 62.0 bits (149), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 FLPYFYVVFLTILLFDRAKRDDDRCRSK*AK 93 FLPYFYV+FLTILLFDRAKRDDDRCRSK K Sbjct: 28 FLPYFYVIFLTILLFDRAKRDDDRCRSKYGK 58