BLASTX nr result
ID: Gardenia21_contig00007328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00007328 (292 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP05983.1| unnamed protein product [Coffea canephora] 62 2e-07 >emb|CDP05983.1| unnamed protein product [Coffea canephora] Length = 527 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 109 MEEGKFDDVTDQISQLPEPILQHILSYLEVKDAIQM 2 MEEG FDD TDQISQLPE ILQHILS+LEVK+AI+M Sbjct: 1 MEEGIFDDATDQISQLPELILQHILSFLEVKEAIRM 36