BLASTX nr result
ID: Gardenia21_contig00007255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00007255 (310 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP19971.1| unnamed protein product [Coffea canephora] 144 2e-32 emb|CDP16131.1| unnamed protein product [Coffea canephora] 73 7e-11 emb|CDP12550.1| unnamed protein product [Coffea canephora] 67 7e-09 emb|CDP12552.1| unnamed protein product [Coffea canephora] 65 2e-08 emb|CDP12549.1| unnamed protein product [Coffea canephora] 65 2e-08 >emb|CDP19971.1| unnamed protein product [Coffea canephora] Length = 516 Score = 144 bits (364), Expect = 2e-32 Identities = 73/103 (70%), Positives = 75/103 (72%) Frame = -1 Query: 310 VNPMANIVFHLNNFFDNCEIVGFHSCNGLLALVFKLDDYDDHREFVVYNPTTRQHRFIPK 131 VNPMA +V HLNNFFDN IV FHSCNGLLALVFKLDD DDHREFVVYNPTT QHR IPK Sbjct: 169 VNPMAKMVSHLNNFFDNGAIVDFHSCNGLLALVFKLDDCDDHREFVVYNPTTCQHRLIPK 228 Query: 130 FSGSKPNHPQLNDAQLNXXXXXXXXXXXXXXXFQITRHFEALN 2 F+GSKPN PQLND N FQITR FEALN Sbjct: 229 FNGSKPNDPQLNDPHFNDPYYDPYFDDPHFHHFQITRRFEALN 271 >emb|CDP16131.1| unnamed protein product [Coffea canephora] Length = 468 Score = 73.2 bits (178), Expect = 7e-11 Identities = 35/60 (58%), Positives = 44/60 (73%) Frame = -1 Query: 310 VNPMANIVFHLNNFFDNCEIVGFHSCNGLLALVFKLDDYDDHREFVVYNPTTRQHRFIPK 131 VNPM NIV +LNN F+N +I+G HSCNGLL + F + D EFVVYNPTT ++R IP+ Sbjct: 153 VNPMGNIVSNLNNLFENADILGLHSCNGLLCVKFCFN--YDSIEFVVYNPTTNKYRLIPR 210 >emb|CDP12550.1| unnamed protein product [Coffea canephora] Length = 461 Score = 66.6 bits (161), Expect = 7e-09 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 1/70 (1%) Frame = -1 Query: 310 VNPMANIVFHLN-NFFDNCEIVGFHSCNGLLALVFKLDDYDDHREFVVYNPTTRQHRFIP 134 V+ M V HL+ NFF + EI HSCNGL+A+V KL D REF VYNP+T QHR IP Sbjct: 141 VSSMETAVSHLSSNFFTDGEITDLHSCNGLVAVVLKLRD--GSREFSVYNPSTSQHRLIP 198 Query: 133 KFSGSKPNHP 104 + + + HP Sbjct: 199 QLNLLEKRHP 208 >emb|CDP12552.1| unnamed protein product [Coffea canephora] Length = 457 Score = 65.5 bits (158), Expect = 2e-08 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 1/73 (1%) Frame = -1 Query: 310 VNPMANIVFHLNNF-FDNCEIVGFHSCNGLLALVFKLDDYDDHREFVVYNPTTRQHRFIP 134 VN MANIV HLN F + I HSCNGLLA+VF ++D+ +EF VYNPTTR+ + +P Sbjct: 157 VNSMANIVSHLNTFLYGPRNISCLHSCNGLLAIVF---NFDNRQEFAVYNPTTRESKLVP 213 Query: 133 KFSGSKPNHPQLN 95 + N+ LN Sbjct: 214 MIE-TPHNYKDLN 225 >emb|CDP12549.1| unnamed protein product [Coffea canephora] Length = 455 Score = 65.1 bits (157), Expect = 2e-08 Identities = 34/67 (50%), Positives = 42/67 (62%), Gaps = 1/67 (1%) Frame = -1 Query: 301 MANIVFHLN-NFFDNCEIVGFHSCNGLLALVFKLDDYDDHREFVVYNPTTRQHRFIPKFS 125 M + HL+ NFF EI HSCNGL+A+V KL + REF VYNPTT QHR IP+ + Sbjct: 144 METAISHLSSNFFTEGEITDLHSCNGLVAVVLKLSN--GSREFAVYNPTTSQHRLIPQLN 201 Query: 124 GSKPNHP 104 + HP Sbjct: 202 LLENRHP 208