BLASTX nr result
ID: Gardenia21_contig00006747
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00006747 (520 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP17135.1| unnamed protein product [Coffea canephora] 69 1e-09 >emb|CDP17135.1| unnamed protein product [Coffea canephora] Length = 70 Score = 69.3 bits (168), Expect = 1e-09 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = -2 Query: 519 ARNVLTKAQKGTAHVRVKAGVGARLVVGAKVLQGEIWYWLVCAA 388 ARNVLTKAQKG A VRVKAGVGA LVVGAK+ QGE+WY LV AA Sbjct: 26 ARNVLTKAQKGAARVRVKAGVGAVLVVGAKLHQGELWYSLVFAA 69