BLASTX nr result
ID: Gardenia21_contig00006459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00006459 (917 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP12199.1| unnamed protein product [Coffea canephora] 60 4e-09 >emb|CDP12199.1| unnamed protein product [Coffea canephora] Length = 103 Score = 60.5 bits (145), Expect(2) = 4e-09 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -2 Query: 796 VCLFLFPNYLFVPFLGCLLFSSQCLEHIELLATYNLFWLEAPVMK 662 V FL Y F GC LF S+C+EHIELLAT+N FWLEAPVMK Sbjct: 49 VHFFLCKFYFNFAFPGCSLFLSRCVEHIELLATFNFFWLEAPVMK 93 Score = 28.9 bits (63), Expect(2) = 4e-09 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -1 Query: 917 ESRKARNSYSKVSLLSLCLPTFID 846 ESRK RNSY + LCLPTFI+ Sbjct: 26 ESRKERNSYG---MEYLCLPTFIN 46