BLASTX nr result
ID: Gardenia21_contig00006023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00006023 (411 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00290.1| unnamed protein product [Coffea canephora] 57 7e-06 >emb|CDP00290.1| unnamed protein product [Coffea canephora] Length = 328 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 92 MSHQQNRHVTSVSASVTPDHPQDSSFQGGE 3 MSHQQNRH+TSVS SVTPD PQ SSFQGGE Sbjct: 1 MSHQQNRHLTSVSDSVTPDRPQGSSFQGGE 30