BLASTX nr result
ID: Gardenia21_contig00005207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00005207 (288 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP05441.1| unnamed protein product [Coffea canephora] 80 6e-13 >emb|CDP05441.1| unnamed protein product [Coffea canephora] Length = 803 Score = 80.1 bits (196), Expect = 6e-13 Identities = 36/47 (76%), Positives = 44/47 (93%) Frame = -3 Query: 286 GEIPSLETIQVYESSESTLESAKQIQESSIEWGNYDMKVFIFHHFEE 146 GEIP+L+TIQVY SSEST+ESA+QI ES+I+ GNYD+KVFIFHHFE+ Sbjct: 756 GEIPTLQTIQVYRSSESTMESARQIHESNIDIGNYDLKVFIFHHFED 802