BLASTX nr result
ID: Gardenia21_contig00005141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00005141 (203 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP12782.1| unnamed protein product [Coffea canephora] 88 2e-15 >emb|CDP12782.1| unnamed protein product [Coffea canephora] Length = 649 Score = 88.2 bits (217), Expect = 2e-15 Identities = 44/67 (65%), Positives = 48/67 (71%) Frame = +1 Query: 1 ALVCMLKTAPPLRQDLHNSANSLHGSKPETLKAKKMDPNQIFGQPVMRQXXXXXXXXXXX 180 ALVCMLK APPL+QDL NSAN LHGS+PE LK+ MDPNQI GQPVM+Q Sbjct: 558 ALVCMLKKAPPLQQDLQNSANLLHGSRPEILKSTTMDPNQISGQPVMQQSAAMSSAASLL 617 Query: 181 XPKTTAD 201 PKTTAD Sbjct: 618 APKTTAD 624