BLASTX nr result
ID: Gardenia21_contig00004406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00004406 (614 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP07554.1| unnamed protein product [Coffea canephora] 83 1e-13 >emb|CDP07554.1| unnamed protein product [Coffea canephora] Length = 407 Score = 83.2 bits (204), Expect = 1e-13 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 129 MESELKTLNPNPAQIQPTQQSPPVDDNLTKDDRPLLKPEQI 7 MESELKTLNPNPAQIQPTQ+SPPVDDNLTKDDRPLLKPE + Sbjct: 1 MESELKTLNPNPAQIQPTQRSPPVDDNLTKDDRPLLKPEPV 41