BLASTX nr result
ID: Gardenia21_contig00004402
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00004402 (966 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP06479.1| unnamed protein product [Coffea canephora] 94 2e-16 >emb|CDP06479.1| unnamed protein product [Coffea canephora] Length = 1377 Score = 94.0 bits (232), Expect = 2e-16 Identities = 45/59 (76%), Positives = 50/59 (84%) Frame = -3 Query: 964 NSGRQPSYSKSLLSCAPKSCLHSIGGKLKICSYLLARTVERMLNFIWNISIKGEEETCG 788 N RQ SY KSLLSCA KSCLHS G KLKICSYLLA++V+ +LNFIWNIS +GEEETCG Sbjct: 1319 NRVRQASYPKSLLSCALKSCLHSFGDKLKICSYLLAQSVDWILNFIWNISNRGEEETCG 1377