BLASTX nr result
ID: Gardenia21_contig00004270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00004270 (260 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266030.2| PREDICTED: 60S acidic ribosomal protein P2 i... 57 7e-06 ref|XP_007202715.1| hypothetical protein PRUPE_ppa012794mg [Prun... 56 9e-06 ref|XP_010651712.1| PREDICTED: 60S acidic ribosomal protein P2 i... 56 9e-06 >ref|XP_002266030.2| PREDICTED: 60S acidic ribosomal protein P2 isoform X1 [Vitis vinifera] gi|297734823|emb|CBI17057.3| unnamed protein product [Vitis vinifera] Length = 145 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 170 EMKVIAAYLLAVLGGNTCPSAEDIKAILGS 259 +MKVIAAYLLAVLGGNTCPSAED+K ILGS Sbjct: 32 KMKVIAAYLLAVLGGNTCPSAEDLKDILGS 61 >ref|XP_007202715.1| hypothetical protein PRUPE_ppa012794mg [Prunus persica] gi|462398246|gb|EMJ03914.1| hypothetical protein PRUPE_ppa012794mg [Prunus persica] Length = 154 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 158 ASISEMKVIAAYLLAVLGGNTCPSAEDIKAILGS 259 AS +EMKV+AAYLLAVLGGNT PSAED+K ILGS Sbjct: 37 ASQAEMKVVAAYLLAVLGGNTTPSAEDLKDILGS 70 >ref|XP_010651712.1| PREDICTED: 60S acidic ribosomal protein P2 isoform X2 [Vitis vinifera] gi|147767214|emb|CAN73396.1| hypothetical protein VITISV_003816 [Vitis vinifera] gi|147782772|emb|CAN65595.1| hypothetical protein VITISV_030546 [Vitis vinifera] Length = 113 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 173 MKVIAAYLLAVLGGNTCPSAEDIKAILGS 259 MKVIAAYLLAVLGGNTCPSAED+K ILGS Sbjct: 1 MKVIAAYLLAVLGGNTCPSAEDLKDILGS 29